SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0LFF7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0LFF7
Domain Number 1 Region: 1530-1648,2032-2069
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 2.35e-24
Family Intein (protein splicing domain) 0.023
Further Details:      
 
Domain Number 2 Region: 967-1093,1458-1491
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.55e-21
Family Intein (protein splicing domain) 0.083
Further Details:      
 
Domain Number 3 Region: 1840-1926
Classification Level Classification E-value
Superfamily Homing endonucleases 0.000000516
Family Intein endonuclease 0.032
Further Details:      
 
Domain Number 4 Region: 1309-1376
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00000102
Family Intein endonuclease 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G0LFF7
Sequence length 2289
Comment (tr|G0LFF7|G0LFF7_HALWC) Exodeoxyribonuclease large subunit {ECO:0000256|HAMAP-Rule:MF_00324} KW=Complete proteome OX=768065 OS=Haloquadratum walsbyi (strain DSM 16854 / JCM 12705 / C23). GN=Hqrw_3990 OC=Haloquadratum.
Sequence
MRDADKQYFETLESHLEQAFARARQAKGQGYDPKPEVEIPVARDMADRVENILAIPDVAE
RIRELDDERSREEVALELVTDFVEGTVGDYDTREGKIEGAVRTAVALLTEGVVAAPIEGI
DRVEILSNDDGSEFVNVYYAGPIRSAGGTAQALSVLVADYARSLLDIDEYSARTDETERY
AEEVSLYDRETGLQYSPKDKETKFITKHMPIMLDGEATGNEEVSGYRDLERVDTNAARGG
MCLVLAEGIALKAPKIQRYTRQLAEVEWPWLQDLIDDTIGSDEHSNNSVKNGEADIIKTD
KDTNESETKDGIDSDDYNDSGLEPANSPRADATNKYLRDLIAGRPVFGHPSAAGAFRLRY
GRARNHGFATAGVHPATMHIVDDFIATGTQLKTERPGKAGGVVPVDSIKGPTVRLANGDV
RCINDPEEAEKLQNGVEKILDLGEYLVNFGEFIENNHPLAPAAYVFEWWIQEFEASNADV
QALRDDPTVDLESPTFENAMRWAKKHDIPLHPAYTYLWHDISVTEFDHLADAVATGEITT
NEVSDTNSASGNTSLRVNTNTDDTLTIDTTPAIRETMERLLIEHHQDSDSIHIPAWRALA
LSLGIKIESDNDTGIGDRMWSLTDLSKHARKQDDGKSAIAAVNEVAPFQVRERAPTRIGS
RMGRPEKSEDRDLSPAVHTLFPIGEAGGNQRNLSDAAQSFGDNTERGQISVQLGKRRCPY
CETVGFELQCAECGRHTEPQFVCRECESVLSPDESGRVHCDRCERDVTSAEWQDIDLHQR
YRDALDRVDERESSFEILKGVKGLTSSNKTPEPLEKGILRAKHGVSSFKDGTVRYDMTDL
PVTAVRPKELDVTAAHFRELGYQTDINGNPLQFDDQLVELKVQDIVLPDGAAEHMMKTAD
FVDDLLEQFYELDQFYQIDERDDLIGELVFGMAPHTSAAVVGRIVGFTSAAVGYAHPYFH
AAKRRNCFHPETKIWFRDTDNEWHHETIQTFVEDRLDDPEIDAVGTLVQEVDDNTDREIS
VPSIDDNGNERLQSVTAVSKHRAPNHLVQIETISGREITITPDHEMHIFEQGNLVSKQAS
KITSGEYAVIPKRLQTISPSSHTPQHDLLREFLTRDELTADWLIIHTSDPVRLCNRVFPE
EVTSCKDAVEIMQNTACHLDENKETLIGWLDEGTIPVVLLRRFVETDEALLMSTPDDVQI
GLRGEKVRIDRHIGFTEELTSLLGYYAAAGIVHAQTNPISYESAQQEQSRITFYNIDTQT
QTDLLNALNSVFEIEPIQYNSDGEILGVPGELIRRVFDTVFDVGTQPSHKRIPQALFDAS
ESHITSYLRCFFSTHDSLTTDTRDISATTVSREFKEDIIAALRRLGITAEVTTQQSRSVP
EVLPDWYAIDDTTHHDANNSLNLTRSYVISIASSDAVTLQRDRQAQEQTKYDAQGLIANN
NAIHQSRQVTDGGRKDYITEPITDIEYVDADIDYTYCLTVSETHSLIVNDLSQKQCDGDE
DCVMLLMDGLLNFSREYLPDKRGGSVAADSRLVAVSPDDKIVFTTIEDFWKKLNTPIERN
GKFRKRTCVSEGWQTYAFDENHEASLRPIEKAIRYKADESKQLRRVTTQFGRSLDITDEH
SLFRYDDGIEEVAGDDLTAGDIIVAPRTLDVETIQTTLDLSEYIHDYERCPGEQTRSEEL
NLASKSVISNPRNKESPVVTHNVSSQRSRSTDEMTTLSPTAVGGLESKQNETLRVGESAE
PVERYIDVDDSFGWLLGQFIAQRSISTDALTSAIHTAAKKHAERIVAASDSVFDINPTVN
STERGCEVVFPPVFDTIVSGLTAKEQSEPEQDINHTHTDEIGIPECILHAPDDIVLSFLQ
GFILGENAQRKGNAASEVSEIVSESETTVTLNTTSVGIKDGLVFLCHRLGIIARISEKSG
GEYSAHFEESRYTVSIATEGKTNPLDQILDGERPTMPEGVSVPVPDALLTIHESIANSPH
IDQVIPDTVVQQETVSLETLQSLLTELSTVDLPAQLEAKRDELTLLTGGDLSYLRVESVE
CIDYDGYLYDLQVGGEPVFTANWLYAHNSMDAPLVMSSRIDPSEIDDEAHNMDIVRQYPR
EFYEATRRMEDPDEWEEEVTIAEEYLDTDNEYTGFNHTHDTTDIAAGPDLSAYKTLDSMM
DKMDAQLELARKLRAVDETDVAERVIEYHFLPDLIGNLRAFSRQQTRCLDCGESYRRMPL
TGECRECGGRVNLTVHEGSVNKYMDTAIHIAEEFDCREYTKQRLEVLERSLESIFEDDTN
KQSGIADFM
Download sequence
Identical sequences G0LFF7
gi|385804896|ref|YP_005841296.1| WP_014557016.1.96088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]