SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0LG39 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0LG39
Domain Number 1 Region: 14-148
Classification Level Classification E-value
Superfamily CheY-like 5.12e-29
Family CheY-related 0.0016
Further Details:      
 
Domain Number 2 Region: 662-799
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.85e-26
Family Histidine kinase 0.0059
Further Details:      
 
Domain Number 3 Region: 457-568
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.01e-18
Family Heme-binding PAS domain 0.082
Further Details:      
 
Domain Number 4 Region: 279-440
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000000000000393
Family GAF domain 0.0087
Further Details:      
 
Domain Number 5 Region: 572-655
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000151
Family Homodimeric domain of signal transducing histidine kinase 0.008
Further Details:      
 
Domain Number 6 Region: 164-245
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000872
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G0LG39
Sequence length 805
Comment (tr|G0LG39|G0LG39_HALWC) Receiver/sensor box histidine kinase {ECO:0000313|EMBL:CCC39059.1} KW=Complete proteome OX=768065 OS=Haloquadratum walsbyi (strain DSM 16854 / JCM 12705 / C23). GN=Hqrw_1084 OC=Haloquadratum.
Sequence
MRLSPMRSESQQQILVLHVDDDPSVTDLTGRFLEREDNRFSVETAISATEGLERIIECSQ
PPDCVVSDYDMPEMDGIDFLQTVREEYPNLPFILFTGKGSEEIASDAISAGVTDYLQKQP
GTEQYELLTNRIQNAVQTQHQRHRAERTDELMRLTEFAGDTGGFEINVDTGEVLMTDGCR
RLVGLADDATLSLKEAIKLYHPDDQPEVRQAVNRAADTGEQTQGSWRLQALDNIDRIVDV
TLTPAIPSQISPHPSHSMSEGKTEDETETDITILRGAIHDVTDSHQREQQLTELNRVSKD
LLTAETQQEVVDIGVTAARDVLDFQANALHLSVSETGDTQLVPVAQTDELMSLLDEVPTL
SVSESIAGRAYQRGEPDIIEDARQHPNAHNPTTNLRGHVYFPLAEHGILIAGSTEKASFD
DQDLAVGELLAGALVAALDRLDREQTARRRAKELSLFFEESPLGAVQWDDKCQFKRVNRQ
AEEILGYSESELRGESWELIVADTDLERVGNAVDSFLNADGGSHIINSNVTKAGETLTCE
WHNRVVTDADGTVQSVFSSFEDISARKQRRTELQEYKQELEAQNERLAEFTGIVSHDLRN
PLAVAEGHLELAMTQTQDVGNNYTDGDANGNHIIKARHAIERCQRLIEDLLTLARDGDRV
DDIEPIRFDTMIEECWETVETTTATLTIADQRSHSDLYIKADKSRLKQLLENLYRNAVEH
GGDQVIVSAGIMSDGFYVSDTGPGVPKSAREKIFNAGYSTAENGTGFGLRIVKQVADAHG
WEIDVTNDTEQGGARFEFTGVQFVD
Download sequence
Identical sequences G0LG39
gi|385802454|ref|YP_005838854.1| WP_014555004.1.96088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]