SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0LGL3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0LGL3
Domain Number 1 Region: 1-162
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.58e-31
Family GHMP Kinase, N-terminal domain 0.00095
Further Details:      
 
Domain Number 2 Region: 173-318
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 7.19e-29
Family Mevalonate 5-diphosphate decarboxylase 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G0LGL3
Sequence length 324
Comment (tr|G0LGL3|G0LGL3_HALWC) Phosphomevalonate decarboxylase {ECO:0000313|EMBL:CCC39565.1} KW=Complete proteome OX=768065 OS=Haloquadratum walsbyi (strain DSM 16854 / JCM 12705 / C23). GN=Hqrw_1624 OC=Haloquadratum.
Sequence
MKATARAHPIQGLIKYHGMRDSDKRYPYHDSISVCTAPSATTTTVEFQSDASGDVYIIDN
ERVEGRAAERIDAVVEHVRERTGIRDPVRLVSTNSFPSNIGFGSSSSGFAAAAMALVTAA
GEELTHPEISTIARRGSSSAARAVTGAFSQLYSGMNDTDCHAERIETDLDATVRTVAAHV
PAYKETEEAHREAAQSHMFDARLAHVHHQIDAMRDALYDADFDRIFELAEHDSLSLTAAT
MTGPAGWVYWQPQTIAVFNTVRELRERESIPVYFSTDTGASVYVNTTAAHVDTVESAISD
IGIDTDIWTVGGPATVLSASDSLF
Download sequence
Identical sequences G0LGL3
WP_014555400.1.96088 gi|385802924|ref|YP_005839324.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]