SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0LID2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G0LID2
Domain Number - Region: 168-231
Classification Level Classification E-value
Superfamily S13-like H2TH domain 0.000883
Family Middle domain of MutM-like DNA repair proteins 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G0LID2
Sequence length 719
Comment (tr|G0LID2|G0LID2_HALWC) DUF814 domain protein {ECO:0000313|EMBL:CCC39852.1} KW=Complete proteome OX=768065 OS=Haloquadratum walsbyi (strain DSM 16854 / JCM 12705 / C23). GN=Hqrw_1937 OC=Haloquadratum.
Sequence
MDPKQELTSVDIAALVTELRRYTGAKVDKTYRYGDDLLRFRMRDFDRGRLELLIEVGTQK
RIHTADPDHVPDAPERPPNFAMMLRNRLSGADLVNVEQFEFDRIMILSFERGEEMTRIIV
ELFGDGNVAVVDSAGEVIQSLETVRLKSRTVAPGAQYEFPDSRVNPLQVTYDRFVSLMNE
SDTDIVRTLATQLNLGGLYAEEVCARAGIDKTTQITNTSDKIYRAIYTALESLGTQLQSG
DFEPRLYADDDAVIDATPFPLEERKQQNLDVTAYDSFNGALDVYFREVDRNPAAEESGQT
RPDFAAEIAKKQRIIEQQEGAIDDFEQRAEAERSRAELLYANYELVNEIIETIQTARAED
TSWDEIRETFAMGAERGIDAAAAVVSVDGAEAMVTIEIDDVRVPVNVDVGVEKNADQRYT
EAKRIEEKKEGALTAIENTREELNAVKQRRDAWDREDAKPDTEDNADNTETVTDKVNTGT
EPSRMGPTNDEWLSMTSIPLQKNDDWYEQFRWFHTSTGYLVVGGRNADQNETLVKKYLNK
HDRFFHTEAHGGPITILKASGPSEPAEPIELTAETRREVAQFAISYSSIWKEGRYADDAY
VVTPDQVSKTPESGEYIEKGSFVIRGDRTYIRDVAAEIAVGIQCADETQVIGGPPSAIAD
RVPTMVQVRPGRYAQNDAAKLAYREFRNRFADESFVRKIASPDKIQEFLPPGGSDLVDE
Download sequence
Identical sequences G0LID2
WP_014555608.1.96088 gi|385803199|ref|YP_005839599.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]