SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0LJN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0LJN8
Domain Number 1 Region: 218-330
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.85e-26
Family Histidine kinase 0.0081
Further Details:      
 
Domain Number 2 Region: 25-131
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.84e-16
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.067
Further Details:      
 
Domain Number 3 Region: 126-192
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000000000216
Family Homodimeric domain of signal transducing histidine kinase 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G0LJN8
Sequence length 336
Comment (tr|G0LJN8|G0LJN8_HALWC) Sensor box histidine kinase {ECO:0000313|EMBL:CCC40972.1} KW=Complete proteome OX=768065 OS=Haloquadratum walsbyi (strain DSM 16854 / JCM 12705 / C23). GN=Hqrw_3189 OC=Haloquadratum.
Sequence
MASDSSIDLTPEFLAEMIKSVGVGVGIYTKDGQYVYVNESYAELFNVTSSALVGEPLWEI
VSEIDADKFKTYWMSFQDNETRKAETVHRYNGQEVPVATVTTQRSINGTTYHFGTIKDIS
ERKAHERELKRQNERLESFAGVISHDLRNPLNVAQGYIDLLQTDIDRDELHLVDTALDRM
NVLITELLELAQSRNIGEMRSVSIKIVAKQAWQSVDTQQASLSLPETNPQILANNSRLQQ
LFENLLRNAIEHGGPGVNVVIETTSDGFYIADDGSGIPESEHDRIFETGYTTNDSGTGFG
LSIVQQITSGHDWSLQVIKSSEGGARFEITDVEFAT
Download sequence
Identical sequences G0LJN8
WP_014556461.1.96088 gi|385804203|ref|YP_005840603.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]