SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0LM10 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0LM10
Domain Number 1 Region: 22-155
Classification Level Classification E-value
Superfamily S13-like H2TH domain 2.16e-28
Family Ribosomal protein S13 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G0LM10
Sequence length 173
Comment (tr|G0LM10|G0LM10_HALWC) 30S ribosomal protein S13 {ECO:0000256|HAMAP-Rule:MF_01315} KW=Complete proteome OX=768065 OS=Haloquadratum walsbyi (strain DSM 16854 / JCM 12705 / C23). GN=Hqrw_3359 OC=Haloquadratum.
Sequence
MSANNTQDDAAEEEDDDLQYFVRIGTTDLDGTKAVERSLTDMKGIGKRTARIITDVASVD
RHATFGLLEEDEIDSITDAVENLDDHIPGWMTNRREDFFSGDTDHKTGADLEEKRRHDVN
RMKMIDSYKGVRHKRGQKVRGQRTKSTGRTEGTIGVNVEAIKEEAAEAAEEEE
Download sequence
Identical sequences G0LM10
WP_014556568.1.96088 gi|385804355|ref|YP_005840755.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]