SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0LN81 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0LN81
Domain Number 1 Region: 10-153
Classification Level Classification E-value
Superfamily CheY-like 2.56e-28
Family CheY-related 0.0019
Further Details:      
 
Domain Number 2 Region: 709-843
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 7.33e-28
Family Histidine kinase 0.0019
Further Details:      
 
Domain Number 3 Region: 255-384
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.33e-16
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.042
Further Details:      
 
Domain Number 4 Region: 627-703
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000000133
Family Homodimeric domain of signal transducing histidine kinase 0.0043
Further Details:      
 
Domain Number 5 Region: 410-517
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000182
Family Flavin-binding PAS domain 0.034
Further Details:      
 
Domain Number 6 Region: 132-256
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000419
Family Heme-binding PAS domain 0.03
Further Details:      
 
Domain Number 7 Region: 504-623
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000004
Family Flavin-binding PAS domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G0LN81
Sequence length 852
Comment (tr|G0LN81|G0LN81_HALWC) Receiver/sensor box histidine kinase {ECO:0000313|EMBL:CCC41887.1} KW=Complete proteome OX=768065 OS=Haloquadratum walsbyi (strain DSM 16854 / JCM 12705 / C23). GN=Hqrw_5011 OC=Haloquadratum.
Sequence
MTTEEKYKDTIRILHIDDQFDFAEMTTTFLERENDRFNTEIATSANDGLARLAGSTFDCI
ISDYDMPQMDGIDFLETVREEYPDLPFILYTGKGSETIASEAISAGVTEYLQKSSGNEQY
ELLAHRIVNAVDQSQAERRVQQEQQRFQTLFDRLSQPIVEVQYESDEPIVTYVNLAFEDV
FGYEANTLVGDSLDAHIVPDDRVDEAEAINQYVQAGGRLKSRRVTRETVDGLREFLIQNA
VYDDGSGGFAIYTDITDRTERKETLKRNQDLLRHTEQLADVGGWEADMETGEARWTQGTY
AIHDIDPDDEFELSLETGIEFCHPDDQAKIETAISNCHAHGEPFEIELRLITAENEQKWV
RATGEPVYDSDDVTKIRGAIRDITQQHERRQRLEQIETFFEHTQDSRFLISVGEEFVIER
VNQSWEDASGVSAEESCGQTIQDVLDESQVKKVEQKYRNCVEQRETLEYEERLQIGDDPV
HWQTRITPVVIDGEVEYIAGVTRDITDIKHRKQELAELNQKYQTLAKNFPDGAVYLINEN
FEYVYARGEALERADLSPSDIEGHVPHDVFPDELADEACHQYEQAFDGIATTAEQEYNGD
RYRARVTPVESDSKEITHVMAVAQDITEFAEDRKQLKRQNKRLDEFASVVSHDLRNPLSV
AEGNVELLREDCNCNNKRIDRIDSALTRMDDLIENLLTLARADEQINGTESVNLAELSQN
CRQNVETTDADATVNIDITATQSIEADPNRLAQLLENLMRNAIEHTNEDVAVTIGELEDG
FYVEDDGSGVPADKRDDVFEAGYTTTNQGTGFGLSIVKQVVEAHGWEMSLTEGSEGGARF
EVTQVDGLKPST
Download sequence
Identical sequences G0LN81
gi|385802313|ref|YP_005838715.1|NC_017457 WP_014554883.1.96088 gi|385802313|ref|YP_005838715.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]