SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0ME49 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0ME49
Domain Number 1 Region: 179-281
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000124
Family Retroviral protease (retropepsin) 0.028
Further Details:      
 
Weak hits

Sequence:  G0ME49
Domain Number - Region: 64-95
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00209
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G0ME49
Sequence length 403
Comment (tr|G0ME49|G0ME49_CAEBE) Uncharacterized protein {ECO:0000313|EMBL:EGT51946.1} KW=Complete proteome; Reference proteome OX=135651 OS=Caenorhabditis brenneri (Nematode worm). GN=CAEBREN_24018 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MVATRGPSTLQDAVDAAIELQPYADRPKDVAEDTANIKATVYNIEKCSEGERQRRRIHSP
KCHKDPSRFARSKCHECQKMGHISKYCYDKLGRKEAKRRMREDNVKSSRTWKPTKSFKQH
GADGRVSNGEQNEVTKLREQVRTLTLRNNQSAANRHDSREHASEVKQLEGNAVNIISQVP
IRANNISTAALLDTGANITVAGNQLCASLGISTLDQLGSGYATCLGSNPVAMAGTALVTL
KIGSRKYIHRVHFTDGPCTPGENGSYTIIIGNDLLQRMPMLRFDYQSKRVWIGKEALPLG
VRKSATKTSPPMVNQIVAKEDTTQAPTCMVIQLGPGVFTAHGPSKGFSRTGTTEEATADV
NKEEVTTLLEKKIIKDRKDKPAKEEKTGRRNPGRQGRAPARHL
Download sequence
Identical sequences G0ME49
CBN24018 135651.CBN24018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]