SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0MEJ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0MEJ7
Domain Number 1 Region: 279-391
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.5e-18
Family Calponin-homology domain, CH-domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G0MEJ7
Sequence length 472
Comment (tr|G0MEJ7|G0MEJ7_CAEBE) Uncharacterized protein {ECO:0000313|EMBL:EGT52225.1} KW=Complete proteome; Reference proteome OX=135651 OS=Caenorhabditis brenneri (Nematode worm). GN=CAEBREN_14354 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MSLFSRSLNRFTGTASETGPPVNEQNITYRKKLSTVSTSLKGDDGPVAESPRNLYTRPNV
VPLRRKVFDESDGAMISTSSGQTPVELKAAEIRRMNSKKEASLKKEENHAPPPPPIEGTS
ATLAPQTSKTNQKKSRTSTSSLASVFRSRASSPIERMRKFIGRSSSKQPKEISAPSPPST
STSSEPIPNEQQFLVQELEKVRYQLAQTQLELSEQNKKLNKVQMVSCSQQSEPILITNIG
TMTEEIVEEKKRNNVDKENMHPDVICIEDSETSKIQNLKQEIAALKKENAEQKEDFRRTR
KDFILILKEAVLRKDEAEHKLETISKSISDEDDWVTLMSQHRHALRRNVLLMWVQKKLEP
YSDQLTVSNFSSDWTDCRAFCALLYDLFPQTMPDVTVSPIVGDCISRCRRTFQFLEIPFD
ERALGIATSPSQMTDSGADDSSSVSSVYNGLTDWRYVMNTVFVLYKRGVLQK
Download sequence
Identical sequences G0MEJ7
CBN14354 135651.CBN14354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]