SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0NAX1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0NAX1
Domain Number 1 Region: 97-159
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.19e-21
Family Skp1 dimerisation domain-like 0.00031
Further Details:      
 
Domain Number 2 Region: 20-85
Classification Level Classification E-value
Superfamily POZ domain 1.38e-16
Family BTB/POZ domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G0NAX1
Sequence length 182
Comment (tr|G0NAX1|G0NAX1_CAEBE) Uncharacterized protein {ECO:0000313|EMBL:EGT56348.1} KW=Complete proteome; Reference proteome OX=135651 OS=Caenorhabditis brenneri (Nematode worm). GN=CAEBREN_21639 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MVLFGNEGSSKVDKNLDECFILVSSDKKEFPISQQAIKHSKTLAQMISTLNISTNSDEKR
IPVENVQGEHLDLIVQWCEHHKEEPVLEDEKSIDQDFKIPDWDRTFLEVDNETLFHFICA
ANYLDIELLMIIACKTVALMAKGRTPEEMRVIFGVNVDEEEQLMMQTNAAPQVEIVEAEG
EE
Download sequence
Identical sequences G0NAX1
135651.CBN21639 CBN21639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]