SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0NY55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G0NY55
Domain Number - Region: 373-403
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000251
Family Retrovirus zinc finger-like domains 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G0NY55
Sequence length 565
Comment (tr|G0NY55|G0NY55_CAEBE) Uncharacterized protein {ECO:0000313|EMBL:EGT39963.1} KW=Complete proteome; Reference proteome OX=135651 OS=Caenorhabditis brenneri (Nematode worm). GN=CAEBREN_11336 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MVGVKNKGGARPKKEPKVEVTSAAVPNVQVPTKKRVTKKVDAAVAASAAAPSTVQSSPLQ
VVTVGGVKGSGPLVLGTRKEALMIDPSEDLLQLDDDSLSIANDQGMLSETELDEMAHVEK
TEEVIASDKSDSNESVEPMDVSDGEQEKDFVREPSLPVEEIHQVQVQQPPQIQPPQVASR
GNELATQLPPEIWNSLQLLPELVLALDQIRKDFAASNQDQAQFVQKQELKKLLAPLKNLD
VIVPKLMNVEKLATDNLHATRGCAGRIDSHKEARLKESAAQLAHMKDVSQTVKYLTGTIK
SVKDYTARKTVELDKATARPGANKGQGSSSTSCASYAPGLEVMAAHGEMRDIARSYHQDQ
QVQAKAAAAAKPSYQPNKANRCIFCGLKGHPFMECPHYRDPLARRQVLLAQGKCWVCFDD
QCDSSATNCPVTRRRLCPKCSHMPHATRVHHESLCINPKSNQGVVSNNNAIMTAHQGFNE
QVAQSNEQFKRKRTKKQNGQSSNAAAKRSRHHSQSSQRTFVPPIRQISSDQPRDIEEDEN
TAQIVKKKKKSKKTNRKYNKNANDA
Download sequence
Identical sequences G0NY55
CBN11336 135651.CBN11336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]