SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0RBZ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0RBZ0
Domain Number 1 Region: 2-351
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 2.01e-109
Family IF2B-like 0.0000000957
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G0RBZ0
Sequence length 373
Comment (tr|G0RBZ0|G0RBZ0_HYPJQ) Translation initiation factor eIF-2B subunit alpha/beta/delta-like protein {ECO:0000256|HAMAP-Rule:MF_03119} KW=Complete proteome; Reference proteome OX=431241 OS=Hypocrea jecorina (strain QM6a) (Trichoderma reesei). GN=TRIREDRAFT_75304 OC=Trichoderma.
Sequence
MSLLQAVKYQRGKLEVLDQLLLPHEFHYDTVSTRQEAFDSIATMRVRGAPAIAIVASLGL
AVELHNNSIAGTSDGEVIAQIDEALDYLKESRPTAVDLTNAINQLKATIRTAEGKGKDAI
VQAFIEEAERIFEKDLQSNLSIGEHGAQWLQARAGASPDHKISVLTHCNTGALATSGHGT
ALGIIRTLQSKGYLKHAFCTETRPYNQGSRLTAFELVHEGIPSTLITDSMAAALFRTKKA
ENNIAAVIVGADRVVRNGDTANKIGTYQLAVLAKHHGIKFIVAAPTTSIDLETETGDGIK
IEERKREELTQISGAVRVATADQRIDVWNPAFDVTPAEFIDVVVTEKGAVEKGPDGTFDF
SQILPERWAKVVG
Download sequence
Identical sequences G0RBZ0
XP_006962902.1.9351 51453.JGI75304 jgi|Trire2|75304|estExt_GeneWisePlus.C_30418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]