SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0T249 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0T249
Domain Number 1 Region: 6-149,282-414
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.53e-59
Family Capz alpha-1 subunit 0.0000784
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G0T249
Sequence length 421
Comment (tr|G0T249|G0T249_RHOT2) Putative F-actin capping {ECO:0000313|EMBL:EGU11019.1} KW=Complete proteome; Reference proteome OX=1001064 OS=(Yeast) (Rhodotorula glutinis (strain ATCC 204091)). GN=RTG_03239 OC=Microbotryomycetes; Sporidiobolales; Sporidiobolaceae; Rhodotorula.
Sequence
MSDAQARLDAASTFLLQSPPGEVNDVLSDLRAILSSSGLSDSQIESGLLPALTKHNAEQF
TVVESEGKKVLVTPASRIEGASEEEEGTERHVEPREGKEFVFDHLKGLASSASPHTSPFD
AETSTLRISLDQLLSSYVSNHYASGVAAVYTLPDPAYPPPEPAPAAAPSTEETATEPEGT
GETGTIAQDVEGGKEEVADVAADTAEEAEKALPEEGVETVGGEGAEPTGVSAEEAEAGEK
AGEFEFEAVEEDKMDVGTPAAATTAAEEEEAPSATTENAAPVPPQPRPSRLFGLYFVGNK
YNPSNYWTGRWRSTYQLDYAKGTLEGTAQINIHYYEQGNVQLSTTLKSSATLSPSPSPES
VVASIKATESSFQRQLGETYNDLSDASFRGLRRALPNTRSKLDWDKATGMRLGQQIGGGA
Q
Download sequence
Identical sequences A0A0K3CNM5 G0T249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]