SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1KK10 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1KK10
Domain Number 1 Region: 236-477
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.08e-57
Family Decarboxylase 0.000000456
Further Details:      
 
Domain Number 2 Region: 12-205
Classification Level Classification E-value
Superfamily PRTase-like 6.42e-43
Family Phosphoribosyltransferases (PRTases) 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1KK10
Sequence length 480
Comment (tr|G1KK10|G1KK10_ANOCA) Uncharacterized protein {ECO:0000313|Ensembl:ENSACAP00000010169} KW=Complete proteome; Reference proteome OX=28377 OS=Anolis carolinensis (Green anole) (American chameleon). GN=umps OC=Toxicofera; Iguania; Dactyloidae; Anolis.
Sequence
RSKRGHAMEALASALHAAKALRFGEFLLKSGLVSPVYVDLRATASEPSLMNKVADLLFQT
AEDAKLQYDSVCGVPYTALPLATIICSTKRIPMLIRRKEAKDHGTKRLVEGTINPGETCL
IIEDVVTSGSSVLETAEVLRKEGLQVTDAIVLLDREQGGKAVLKKHGIRLHSVCALSQIL
KILEQQQKVSPEMVARVEKFIRENIVEPSEQNGLAPTKRICKEMSFAARAELPGIHPLAA
QLLRIMEKKQSNLCLSADVTTSKELLQLADILGPSICILKTHIDILCDFSQEVVKELRKF
ADQHEFLIFEDRKFADIGNTVKHQYEGGIFKIASWSDIVNAHAVPGPGVVKGLKEVGNPL
QRGCLLIGEMSSEGSLATGDYTKAVVKMAEEHADFVLGFISGSRIAEKPEFLHLTPGVQM
QTGSDNLGQKYLSPQEVIGKRHSDIIIVGRGILSACNQAEEAEAYRKLAWESYLQRIGVG
Download sequence
Identical sequences G1KK10
ENSACAP00000010169 ENSACAP00000010169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]