SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1LBW1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1LBW1
Domain Number 1 Region: 14-152
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.83e-32
Family Calponin-homology domain, CH-domain 0.00085
Further Details:      
 
Domain Number 2 Region: 600-678
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.27e-22
Family DIX domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1LBW1
Sequence length 683
Comment (tr|G1LBW1|G1LBW1_AILME) DIX domain containing 1 {ECO:0000313|Ensembl:ENSAMEP00000004385} KW=Complete proteome; Reference proteome OX=9646 OS=Ailuropoda melanoleuca (Giant panda). GN=DIXDC1 OC=Ailuropoda.
Sequence
MLACLTRGNLLDVLQEGFNEQQLQAYVAWVNAQLKKRPAVKPVQDLRQDLRDGVILAYLI
EIVAGEKLNGVQLSPSNQQEMKNNVEKVLQFVASKKIRMHQTSAKDIVEGNLKSIMRLVL
ALAAHFKPGSSRTVSQGRDFRAPLQSHQPHCATAVAQGAAAALADVCHDVSRSGRDVFRY
RQRNSSVDEEIENPYWSVRALVQQYEGQQRSPSESSCSSLTSPSPIHSAKSESIITQSEE
KADFVIIPSEGIENRTEETDSPFSRDWRPGSPGTSLETSWEEQLLEQQEHLEKEMEEAKK
MISGLQALLLNGSLPEDEQERPLALCEPGVNPEEQLIIIQSRLDQSMEENQDLKKELLKC
KQEARNLQGIKDALQQRLTQQDTSVLQLKQELLRANMDKDELHNQNVDLQRKLDERNRLL
GEYKKELGQKERLLQQHQAKLEEALRKLSEASYQQVDLERELEQKDVLLAHCMKREADEV
TNYNSHNSQSNGFLLPVAGKGAASITHRGTSDLQLIRDALRSLRDSFGGHDPQHHTIDSL
EQGIASLMERLRAMETQKKQDRRVRGKSPRTQAGSEYRESWPPNSKLSHSQSSPAVSSAC
TKVLYFTDRSLTPFMVNIPKRLGEVTLRDFKAAIDREGNHRYHFKALDPEFGTVKEEVFH
DDDAIPGWEGKIVAWVEEDHGEN
Download sequence
Identical sequences G1LBW1
ENSAMEP00000004385 XP_019657215.1.58354 ENSAMEP00000004385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]