SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1LGX2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1LGX2
Domain Number 1 Region: 28-289
Classification Level Classification E-value
Superfamily Carbonic anhydrase 9.03e-80
Family Carbonic anhydrase 0.00000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1LGX2
Sequence length 290
Comment (tr|G1LGX2|G1LGX2_AILME) Carbonic anhydrase 8 {ECO:0000313|Ensembl:ENSAMEP00000006163} KW=Complete proteome; Reference proteome OX=9646 OS=Ailuropoda melanoleuca (Giant panda). GN=CA8 OC=Ailuropoda.
Sequence
MADLSFIEDSVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREAR
YDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWG
RENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLK
AVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPL
TISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ
Download sequence
Identical sequences A0A1U7UB18 F1PWG5 G1LGX2 H0WHV5
ENSOPRP00000014387 9615.ENSCAFP00000010611 ENSCAFP00000010611 ENSCAFP00000010611 ENSOGAP00000000976 XP_002915756.1.58354 XP_003802214.1.62490 XP_004588062.1.84141 XP_008065933.1.4292 XP_008704944.1.72690 XP_008704945.1.72690 XP_008704946.1.72690 XP_011218671.1.58354 XP_544094.2.84170 ENSAMEP00000006163 ENSOGAP00000000976 ENSAMEP00000006163 ENSOPRP00000014387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]