SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1LQ25 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1LQ25
Domain Number 1 Region: 35-120
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 1.31e-16
Family Ribosomal L11/L12e N-terminal domain 0.0000327
Further Details:      
 
Weak hits

Sequence:  G1LQ25
Domain Number - Region: 151-182
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 0.0769
Family Ribosomal protein L11, C-terminal domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1LQ25
Sequence length 199
Comment (tr|G1LQ25|G1LQ25_AILME) Uncharacterized protein {ECO:0000313|Ensembl:ENSAMEP00000009155} KW=Complete proteome; Reference proteome OX=9646 OS=Ailuropoda melanoleuca (Giant panda). GN= OC=Ailuropoda.
Sequence
SKCKRLELFGSRLGGGEGATVFGHPETGASTPAASTTPPKFDPDGTKVVHLRCSHGEVAV
TSAPAPRLGPLGLSPKKDGDDIAKATGDWKGLRMTKLTIQNRQAQTEGEPAGSALTTRAL
KEPPRGRRKQKDMGKCLDGNGNTTLDESVNRSTALARELSGTTNEVPGTARSVGRSVDGR
HPRDITDDVNSGAVEQPAR
Download sequence
Identical sequences G1LQ25
ENSAMEP00000009155 ENSAMEP00000009155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]