SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1MSR4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1MSR4
Domain Number 1 Region: 1-56
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000377
Family Calmodulin-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1MSR4
Sequence length 138
Comment (tr|G1MSR4|G1MSR4_MELGA) EF-hand domain family member D1 {ECO:0000313|Ensembl:ENSMGAP00000001384} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=EFHD1 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
YDSGRDGYIDLMELKLMMEKLGAPQTHLGLKNMIKEVDEDFDGKLSFREFLLIFHKAAAG
ELEEDSGLLTLAKLSEIDVSIEGVKGAKNFFEAKVQALSSASKFEAEIRAEQDERKREEE
ERKHRRAAFRELKSAFTQ
Download sequence
Identical sequences G1MSR4
ENSMGAP00000001384 ENSMGAP00000001384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]