SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1MUW1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1MUW1
Domain Number 1 Region: 45-192
Classification Level Classification E-value
Superfamily EF-hand 2.38e-35
Family Calmodulin-like 0.00000214
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1MUW1
Sequence length 194
Comment (tr|G1MUW1|G1MUW1_MELGA) Myosin light chain 3 {ECO:0000313|Ensembl:ENSMGAP00000002363} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=MYL3 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
MPPKKPEPKKAPEPKKEEPKPAPKPAEPEPKKEVEFNPASIKVEFTPDQIEEFKEAFSLF
DRTPKSEMKITYAQCGDVLRALGQNPTQAEVMKVLGRPKQEDMNSKMIDFETFLPMLQHI
AKTKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGERLTEEEVDKLMAGQEDANG
CINYEAFVKHIMAN
Download sequence
Identical sequences G1MUW1
XP_003206959.1.16129 XP_015708474.1.68032 ENSMGAP00000002363 ENSMGAP00000002363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]