SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1MXE9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1MXE9
Domain Number 1 Region: 233-433
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.88e-47
Family DBL homology domain (DH-domain) 0.0000000981
Further Details:      
 
Domain Number 2 Region: 425-549
Classification Level Classification E-value
Superfamily PH domain-like 2.49e-36
Family Pleckstrin-homology domain (PH domain) 0.000008
Further Details:      
 
Domain Number 3 Region: 1-122
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.57e-25
Family Calponin-homology domain, CH-domain 0.001
Further Details:      
 
Domain Number 4 Region: 163-231
Classification Level Classification E-value
Superfamily SH3-domain 5.51e-24
Family SH3-domain 0.0000298
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1MXE9
Sequence length 773
Comment (tr|G1MXE9|G1MXE9_MELGA) Rac/Cdc42 guanine nucleotide exchange factor 6 {ECO:0000313|Ensembl:ENSMGAP00000003512} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=ARHGEF6 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
MNPEEQVVTWLISLGVLNSPKKIIDDPEEFLKTSLKDGTVLCKLIHRLLPGSAEKYCLEP
KNEADCIGNIQEFLRGCAALKVELFEPHDLYSGEQFSKVLSTLTAVNKATEDQPSEGPCS
HPSALSSAAGGAHTDSNSTASQSAKVLRRQSKAVEMTENGSHQLVVKARFNFKQTNEDEL
SVNKGDIIYVTRVEEGGWWEGTLNGKTGWFPSNYVREIKSTDKPLSPKALKGLESTQLTK
NYYPVVLQNILETERDYAKELQSLLGTYLRPLQSYDKLSAVDIASLLGNVEEISAFQQTL
NQALEDVAKLPENQQRVGGCFMNLMAQFRSLYLTYCANHPSAVNVLTQHSDELEKFMESQ
GAANPGILILTTSLSKPFLRLDKYVTLLQELERHVEEAHADHEDILKAITSFKSLVSQCQ
ELRKRKQLELQILSESIQRWEGEDIKTMGNIIYMSQVMVQSGSSEEKEERYFLLFSNVLL
MLSASPRMSGFIYQGRLPLTGMTLTKLEDAEGNEHVFEIAGNMMERITVSCSTSQDLHEW
LEHLQRLTKGTCNTVSKTQSWSAHSTFGSTGQIRGPLEPPKILKPWSLSCLRPAPPLRPS
AALSYKERMSYILKDSSKSPKTMKKFLPKRKTERKASDEEFVIRKSTAALEEDAQILKVI
EAYCTGAGFQQALSSGSRKDSIPQVLLPEEEKIIIEETRSNGQTVTEEKSLVDTVYALKD
EVKELKQENKRMKQCLEEELKSRKDLEKLVRRLLKQTDECSREETGRKSSLIA
Download sequence
Identical sequences G1MXE9
ENSMGAP00000003512 XP_010713514.1.16129 ENSMGAP00000003512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]