SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1N215 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1N215
Domain Number 1 Region: 624-924,963-1017,1063-1118
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.11e-65
Family Calponin-homology domain, CH-domain 0.0016
Further Details:      
 
Domain Number 2 Region: 1372-1470
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000173
Family Motor proteins 0.036
Further Details:      
 
Domain Number 3 Region: 2450-2524
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000109
Family Motor proteins 0.022
Further Details:      
 
Domain Number 4 Region: 1645-1721
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000114
Family Motor proteins 0.021
Further Details:      
 
Domain Number 5 Region: 1870-1942
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000345
Family Motor proteins 0.019
Further Details:      
 
Domain Number 6 Region: 2719-2797
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000398
Family Motor proteins 0.032
Further Details:      
 
Domain Number 7 Region: 1120-1235
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000531
Family Motor proteins 0.056
Further Details:      
 
Domain Number 8 Region: 1794-1871
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000077
Family Motor proteins 0.021
Further Details:      
 
Domain Number 9 Region: 1442-1564
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000266
Family Motor proteins 0.027
Further Details:      
 
Domain Number 10 Region: 2090-2163
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000319
Family Motor proteins 0.04
Further Details:      
 
Domain Number 11 Region: 2015-2087
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000425
Family Extended AAA-ATPase domain 0.085
Further Details:      
 
Domain Number 12 Region: 2161-2238
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000119
Family Motor proteins 0.04
Further Details:      
 
Domain Number 13 Region: 2528-2604
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000181
Family Motor proteins 0.038
Further Details:      
 
Domain Number 14 Region: 2381-2453
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000258
Family Motor proteins 0.04
Further Details:      
 
Domain Number 15 Region: 1575-1645
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000319
Family Motor proteins 0.038
Further Details:      
 
Domain Number 16 Region: 2233-2304
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000266
Family Motor proteins 0.042
Further Details:      
 
Domain Number 17 Region: 1726-1797
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000425
Family Motor proteins 0.047
Further Details:      
 
Weak hits

Sequence:  G1N215
Domain Number - Region: 3075-3199
Classification Level Classification E-value
Superfamily ARM repeat 0.000106
Family Armadillo repeat 0.061
Further Details:      
 
Domain Number - Region: 1938-2023
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000141
Family Motor proteins 0.046
Further Details:      
 
Domain Number - Region: 1204-1305
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000558
Family Extended AAA-ATPase domain 0.056
Further Details:      
 
Domain Number - Region: 2310-2380
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000637
Family Motor proteins 0.047
Further Details:      
 
Domain Number - Region: 1303-1375
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00236
Family Motor proteins 0.042
Further Details:      
 
Domain Number - Region: 2656-2717
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0046
Family Motor proteins 0.07
Further Details:      
 
Domain Number - Region: 2790-2950
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0122
Family Motor proteins 0.0089
Further Details:      
 
Domain Number - Region: 2987-3043
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0319
Family Motor proteins 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1N215
Sequence length 3293
Comment (tr|G1N215|G1N215_MELGA) Abnormal spindle microtubule assembly {ECO:0000313|Ensembl:ENSMGAP00000005623} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=ASPM OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
QRIFVYVTWTPSEEGKVRELVTFVVNGIVKHQAVLLGVAEQPVKKKKSLWDTIKKKNSSE
TSIPRKINKRNSKVKNVNKTFQVSQEADRLRSPLQSCENQNAMQNSTSPVNESPVGSENK
LPISPIAPVLEELRTTACTPLSMRRSTTFSDIAAAVNEGLLPVMDSHNFNKSVDDHSELK
SGSAYSCSGLGKPPISNDEVILNCTLSPVCTPEHSSSVPFLSTRRFLSPDSFVNDNYQVD
GDIVVPSVPILSPDQFVKDMQLYMQSKTPKPEAALISSTTETYVVKECVPSKQKENGDRW
TKTQVHVEHVLNEAFEVRCVDSQVPHHNKSKENHFTCPPIGEFQTRSSQIEQPKKRPVLS
ATVIKNKPNADERKKMEMLQPKSKKCLNSAIMTCENMVPLYTKAEISERLPVIGPVSAGN
KCPSDKVSSSTESTSLCRKRKNEVSVEKNRVVGPVHVEEVERKRALTSSMDNKTQATVRP
SAFKHTTRERIGQNKKAGSSLQKASKTNSRINKPIAGLAQSHLTFVKPLKTVIPRHPMPF
AAQNMFYDERWKEKQQRGFTWWLNFVLTPDDFSVKTNTSQVNAAALILGEENHHKTSVPK
APTKEEASLKAYTARRRLNKLRRDACRLFTSETMVKAIKKLEVEIETRRLLVRRDRHLWK
DVGERQKVLNWLLSYNPLWLRIGLETVYGELITLESNSDFMGLAIFILNRLLWNPDIAAE
YRHPTVPHLYREGHEEALSKFTLKKLLLLVCFLDRAKQSRLIGHDPCLFCKDAEFKTSKD
ILLAISRDFLSGEGDLSRHLGFLGLPVSHIQTPLDEFDFAVTNLAVDLQCGIRLVRAMEL
LTRDWNLSKQLRVPAISRLQKMHNVDIVLSVLKKRGIHLKDDSGASIDCRDIVDRHRERT
LALLWKIVFAFQVDILLNVEQLKEEIQFLKNAHKIKMQLGALKLFSSCCRIQEDNSSSPS
PQSHGENVKLLMAWVNAVCGFYNIKVENFTVCFSDGRVLCHLIHHYHPCYVPLEAVCQRT
TQTVECSRTHKVGLNCSSSSESDTSLNVMEGPFDQTVTASVLYKELLENEKKNFQLINNA
VSDLGGIPAMIHYSDMSNTIPDEKVVITYLSFLCSRLLDLRQETRAARLIQSAWRKFRLK
RELKLSQERDRAARIIQKYAINFLSHRRLVKKHNAAVIIQKHWRRHLARIIFLNLKKTKW
EEARSKSATVIQAYWRRYSARKSYLQLRYYVIFVQARIRMLLAVAAYKRILWATVTIQNR
LRASNLAKEHRKRYEILRSSALTIQSAFRKWRKHKIQEKIRAAVVLQRYFRKWQSSKLTK
RKRAALLVQSWYRMHRDMKRYLRIKQSIIKIQAWYRCQIARRIYQEYRAQIVMIQQHYRA
YKLGKNEREIYLQKRAAVVVLQAAFRGKKARILYRQTKAACVVQSLWRMRQARQRFLLIK
KSVTLLQSHVRKHQQVKRYKEMKNAASVIQAWFRAHVTSKKAALSFQRMRLAAIVLQSAY
RGRKARKEAHILRSVIKIQSSFRAYVIRKRFEDLRNATVKIQACVKMRQARRYYRALREA
TLYVQRRYRSRRYALQLKEDYRKLKGACIRIQAAVRGCLVRKQIKRWRETAVFLQAQYRM
RRTRARYLLMYSAAVVIQKHYRAYHKQLCQRQEFLQAKKAAVCIQAGYRGYKARKKLKLE
HRSAVKIQAAFRAHATRKKYQAMIQASVVIQRWYRTCKTSNRQRLTFLKTRAAVLTLQAA
FRGYQVRKQIRRQCAAATAIQSAFRKFMALKTFRLMNHAVLNIQRRYRAIVISRKQRQEY
VELRNCVVRLQAIWRGKAARKKIQKMHNLATIIQSYYRMHVNQLKFKKLRRSTLVIQRYF
RAYCMKKNQRARYLKTKAAVLVLQSAYRGMTVRKQLRELSKAATTIQAAFKSYLVKKDYV
GLRSAAVVIQRRYRAVIHTKWQRQKYLSLKAAAIKMQAIYRGVKVRRQIHSMHRAAIRIQ
AMFKMHRINIRYQAIRMAAIIIQRQYRAFCLGRVQRKKYLELKKSSIVLQAAFRGMKVRQ
DLKMMHQSAALIQSYYRVHKQQRDFRNLLLATRRIQQWYRACKERNRQVHNYMTVRSATL
CLQAAFRGMKARRLLRTMNHSAELIQRRFRTFLQRKRFISLRTAAVVIQRKYRATKLAKI
QRQQYLSLLNAAVIIQSAYRGFLARQKMRQMHQAATVIQATLRMRKIYISYQVLRLASVI
IQQRYRAYREGKRVRKMYLKTYKSVLVIQAAYRGMKTRCFLKKRHEAALIIQRNYRMYRQ
YHRYRRVQWATQLIQRKFRANSLRNIAVQRYFSFKKAAICIQRAFRDMRLKKQHQEMHRA
ATVVQKNYKAFREHQRYLSLKAAALVFQRRYRALILSRQHTQEYLYLRRATIRLQAVYRG
IRVRKSIEHMHLAARTIQSAYKMHRNRSAYQKMRTAAVVIQNYYRSYVKAKNQQKKYLTI
KKSALLIQASYRGMKERQQLKMMRASAIIIQSSYRMYIQHKYYKQLCWAVRVIQQRFRAK
IAKKADMENYAKIRKAIICLQSSFRAKKARQLRKTNAAALCIQSFLRMRVERKRFLVKKA
AAITIQSAFRCQRARARYKSVQNSIVAIQRWYRACHSARLQKAEYSLQRQAIIIIQSAYR
GMKARKLTRQIRATRKIQSFLQMAVQRRKFIQLKRAAITLQACYLMHKAKSQYASYKKAA
VVLQRWYRSHLIVKHQRMTYLQTQKKIILVQAVVRRFIVKKRFQKIKESAIKIQASYRGF
KARRLANKVRAARVIQAWFRGCKARKEYASMVEAVRIIKSHFRTKRQRTWFLKMKFCALT
IQRRWRATLAARMVRLQFLATKKKHEAACLIQTTYRCFKERRKLDRQKAAAVTIQKHLRA
WQEGRLQFMKYNKIRRAVIKLQAFIRGYLVRKKFLEQKQKKRLLYFIAAAYHHVSAIKIQ
RAYRMHLAYKLAENHISSVLIIQKWFRAKMQRRRFQRDLQRIVQCQRMIRGWLNRRNDAA
TVIQRHVRRFLACRRKRKIAVGIIKFQALWRGYSWRKNNDTAKTKALRLSLEKANRKSKE
ENKLCNRTSIAIEYLLKYKHISYILAALKHLEVVTRLSPLCCENMAQSRAIFTIFVLIRS
CNRSVPCMDVIRYSVQVLLNVSKYERTTQAVYEVDNCIDTLLDLLQMYRGKAGDKISEKG
GSIFTKTCCLLAILSKDSKRALEIRSMPRVVTCIQSLYKLTARKCKMDAERTLAKQKTST
LISGISFIPVTPLRIKTVSRIKPDWVLRKDNMQEVVDPLQAIVMVMDTLGIAC
Download sequence
Identical sequences G1N215
ENSMGAP00000005623 ENSMGAP00000005623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]