SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1NAP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NAP4
Domain Number 1 Region: 11-271
Classification Level Classification E-value
Superfamily YWTD domain 5.75e-56
Family YWTD domain 0.00000202
Further Details:      
 
Domain Number 2 Region: 623-878
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-55
Family YWTD domain 0.00000508
Further Details:      
 
Domain Number 3 Region: 322-552
Classification Level Classification E-value
Superfamily YWTD domain 9.42e-50
Family YWTD domain 0.00000227
Further Details:      
 
Domain Number 4 Region: 925-1184
Classification Level Classification E-value
Superfamily YWTD domain 6.93e-39
Family YWTD domain 0.0000568
Further Details:      
 
Domain Number 5 Region: 1315-1350
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000668
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 1277-1313
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000126
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 578-624
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000223
Family EGF-type module 0.013
Further Details:      
 
Domain Number 8 Region: 1236-1276
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000314
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 9 Region: 881-926
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000399
Family EGF-type module 0.039
Further Details:      
 
Domain Number 10 Region: 276-319
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000177
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1194-1246
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000209
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1NAP4
Sequence length 1595
Comment (tr|G1NAP4|G1NAP4_MELGA) Low-density lipoprotein receptor-related protein {ECO:0000256|PIRNR:PIRNR036314} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=LRP5 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
YVFVFSSVASPFLLFANRRDVRLVDAGGTKLESTVVVSGLEDAAAVDFQYSQGIVFWTDV
SEEAIKQTYINQTGNVVQNVIISGLVSPDGLACDWIGKKLYWTDSETNRIEVANLNGTSR
KVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDSSTRKIIVDSDIYWPNGLTI
DLDEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHA
CNKRTGEKRREILSALYSPMDIQVLSPDRQPYFHTPCEENNGGCSHLCLLSPRDPFYSCA
CPTGVQLEDDGRTCKSGAEEVLLLARRTDLRRISLDMPDFTDIILQIDNIRHAIAIDYDP
VEGYIYWTDDDVRAIRRAYLDGSGAQTLVTTEINHPDGIAVDWVARNLYWTDTGTDRIEV
TRLNGTSRKILISENLDEPRAIVLNPVMGYMYWTDWGESPKIECAYLDGSERRVLVNTSL
GWPNGLALDLEEDKLYWGDAKTDKIEVINVDGTMRKTLLEDKLPHIFGFTLLGDYIYWTD
WQRRSIERVHKIRASRDIIIDQLPDLMGLKATSVTKVFGTNPCAENNGGCSHLCFFTPQE
TRCACPIGLELLSDMKTCIIPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDF
DVSDNRIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRI
EVARLDGQYRQVLVWKDLDNPRSLALDPTKGYMYWTEWGGKPRIVRAYMDGTNSITLVDK
VGRANDLTIDYADQRLYWTDLDTSMIESSNMLGQEREIIADDLPHPFGLTQYSDYIYWTD
WNLHSIERADKTSGKNRTLIQGHLDFVMDILVFHSSRQDGLNDCVQNNGHCGHLCLAIPN
GFRCGCAAHYTLDPNSRNCSSPTSFLLFSQKSAISRMIPDDQQSPDIILPMHGLRNVKAI
DYDPLDKLIYWVDGRQNIIKRAKDDGTQPFTVMSSPNQSQNPEKQPHDLSIDIYSHTLYW
TCEATNSVNVHRLNGESIGMVLRGDHDKPRAIVVNAERGYMYFTNMQERAPKIERAALDG
TEREVLFTTGLIRPVALVIDNKLGKLFWVDADLKRIESCDLSGANRVTLEDSNILQPMGL
TVLGNHLYWIDRQQQMIERVEKTNGYKRTRIQGRIAHLTGIHAVEELDMEEFSAHPCSRD
NGGCSHICIAKGDGTPRCSCPEHLVLLQNLLTCGEPPTCSPDQFTCATGEIDCIPMAWRC
DGFPECDDQSDEDSCPICSASQFQCEKGQCIDAHLRCNGEIDCQDKSDEVDCDTICLLNQ
FRCASGQCILLKQQCDSFPDCIDGSDELMCEKSKPSSDEPQPHSSAIGPVIGIILSLFVM
GGMYFVCQRVVCQRYAGPNSPFPHEYVSGTPHVPLNFIAPGSSQHGTFTGISCGKSMISS
MSLMGGSSGAPLYDRNHVTGASSSSSSSTKATFYPQILNPPPSPATDRSLYNAEMFYSSN
IPSTTRSYRPYLIRGTAPPTTPCSTDVCDSDYTTSRWKANKYYIDLNSDSDPYPPPPTPR
SQYMSAEESCPPSPATERSYFHLYPPPPSPCTDSS
Download sequence
Identical sequences G1NAP4
ENSMGAP00000009617 ENSMGAP00000009617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]