SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1NC86 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NC86
Domain Number 1 Region: 2-197
Classification Level Classification E-value
Superfamily EF-hand 3.74e-23
Family Calmodulin-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1NC86
Sequence length 206
Comment (tr|G1NC86|G1NC86_MELGA) Tescalcin {ECO:0000313|Ensembl:ENSMGAP00000010332} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=TESC OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
PELRALGEQHSFTSEQIEQLHRRFKQLSHNRKTIRKEDFDTIPDLEFNPIRARIVHAFFD
KRNLRKAPAGLAEEINFEDFLTIMSYFRPIEMDMDEERLESFRKEKLKFLFHMYDADYDG
IITLQEYKNVLDELMSGNPHLEKESLRAIAEGAMLEAASACMARTGPDEVYEGITFEDFL
KVWKGIDIETKMHVRFLTMEAIAHCY
Download sequence
Identical sequences G1NC86
ENSMGAP00000010332 ENSMGAP00000010332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]