SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1NET5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NET5
Domain Number 1 Region: 1-124
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.27e-34
Family Calponin-homology domain, CH-domain 0.00092
Further Details:      
 
Domain Number 2 Region: 1913-2050
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000966
Family Extended AAA-ATPase domain 0.082
Further Details:      
 
Domain Number 3 Region: 1942-1994,2060-2147
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000482
Family Nucleotide and nucleoside kinases 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1NET5
Sequence length 2278
Comment (tr|G1NET5|G1NET5_MELGA) Neuron navigator 3 {ECO:0000313|Ensembl:ENSMGAP00000011471} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=NAV3 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
QIYTDWANHYLAKSGHKRLIKDLQQDIADGVLLAEIIQIIANEKVEDINGCPRSQSQMIE
NVDVCLSFLAARGVNVQGLSAEEIRNGNLKAILGLFFSLSRYKQQQHHQQQYYQSLVELQ
QQVPSSPAEISQSKTQDMQSSLTARYATQSNHSGIATSQKKASRLPGPSRVPAAGSSTKV
QGASNLNRRSQSFNSIDKNKPPQYANGNEKADSPKGPHPSAGMNGNVQHPTSTGQQQVSA
IPSPSASKPWRSKSMNVKHSATSTMLSVKQPSPATSPTPSSDRLKPPPSEGVKPPSSGQK
SMLEKFKLVNARTALRPPLSLSSGPSDSGREDDTFSECGEVDVLSGGVNSSGSTSSSPKV
SPKLTPPKAGSKNLSNKKSLLQPKDKEEKNRDKNKVCTEKTVKEEKDQVTEASTKKSSKI
ASLIPKGSKTATAKKESLIPSSSGIPKPGSKVPTAKQSTSSACVGSKEAEKLRTTKGNQS
QPTPKSQLNEKASPSCGLAFSEGKEPSTALTPGPSTALSGTATSSGQSTGNGVVQLPQQQ
QYSHPNTATVAPFIYRTLSENDSTSLPPADSCTSPTKMDLSFSKTAKQCLEEISGEDPET
RRMRTVKNIADLRQNLEETMSSLRGTQISHSTLETTFDSTVTTEVNGRSIPSLTSRSTPV
TWRLGQASPRLQAGDAPSLGAGYPRSSTSRFIHTDPSRFMYTTPLRRAAVSRLGNISQID
VSEKGSSDLDMSSEVDAGGYMSDGDILGKSLRTDDINSGYMTDGGLNLYTRSLNRIPDLA
TSRDVIQRGVHDVTVDADSWDDSSSVSSGLSDTLDNLSTDDLNTTSSVSSYSNITASSRK
NAHAQLKTDLEKRSVTDSETWGSTEELKKPEEDFDSNIDSSGKWKGLPSGLSEESEKGGQ
KAPLSQTGSWRRGMTTQVGATQSRHKAGTSALKTPGKTDDAKASEKVKTPLKGASIQRSP
SDAGKSSGDEGKKPPSGIGRSTVTGSFGFKKSGMGSSTIITTSGATITSGSATLGKMPKS
SAIGSKSNAGRKTSLDGSQNQDDGVLHVNSKTTLQYRSLPRPSKSSGSGIPGRGGHRSST
SSIDSNVSSKSAGAAATKLREPSKIGSGRSSPVTINQTDKEKEKVAVSDSESVSLSSSPK
SSPTSASASGTPGLRQPGSKYPDIASPTFRRLFGAKASGKAASAPSTEGVKPTSAMPSPS
TTLARQGSLESPSSGTGSMGSAGGQSGSSSPLFSKPSDLNADVVSLSHSLASSPASVHSF
TSGALVWAANLSSSSAGSKDTPSYQSMTSLHTSSESIDLPLSHHGSLSGLTTSTQEVQSL
LMRTGSVRSTLSESMHLDRNTLPKKGLRYTPSSRQTSQEEGKEWLRSHSTGGLQDTGSQS
PLVSPSAMSTSATGKYHFSNLVSPTNLSQFNLPGPSMMRSNSIPAQDTSFDLYDDSQLCG
SATSLEERPRAISHSGSFRDSMEEVHGSSLSLVSSTSSLYSTAEEKAHSEQIQKLRRELV
ASQEKVATLTSQLSANVSISAAAEKHCQICQGYVQVLTTWYCKERFDFMEFHEKVLGTLS
SQNWVARHGLSRDFKSNPKTPLDLRIRRQHSSESVSSINSATSHSSIGSGNDADSKKRKR
KTGLRSSFKQAFGKKKSTKPPSSHSDIEEQTDSSLPSSPKLPHSSGECGATSMKPSQSAS
AICECTEAEAEIILQLKSELREKELKLTDIRLEALSSAHHLDQIREAMNRMQNEIEILKA
ENDRLKAETGNTGKPARPSSESSSSTSSSSSRQSLGLSLNNLNITESVTSDILLDDVTDG
ALHKEGHSVKILVTINKGYSRSKDQKSHTYLIGSIGVSGKTKWDVLDGVIRRLFKEYIFR
VDPAASLGLSSDCIASYCIGDVIRAHSLEVPELLPCGYLVGDNNIITVNLKGVEENSLDS
FVFDTLIPKPITQRYFNLLMEHRRIILSGPSGTGKTYLANRLAEYIITKSGRKKTEDAIT
TFNVDHKSSKDLRQYLANLAEQCSADNNGADLPVVIILDNLHHISSLSDIFNGFLNCKYN
KCPYIIGTMNQGVSSSPNLELHHNFRWVLCANHTEPVKGFLGRYLRRKLIETEIEKNIRN
NELIKIIDWIPKTWHHLNSFLETHSSSDVTIGPRLFLPCPMDVDGSRVWFTDLWNYSLVP
YLLEAVREGLQMYGKRAPWEDPSKWVADTYPWSSASLQHEWPSLLQLRPEDVGYEGYASA
KEGTTSKHVPQTDTEGDPLMNMLMRLQEAANFSSAQSCDSDSTSHHDDILDSSLESTL
Download sequence
Identical sequences G1NET5
ENSMGAP00000011471 ENSMGAP00000011471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]