SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1NJ66 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NJ66
Domain Number 1 Region: 3-65
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000543
Family Parvalbumin 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1NJ66
Sequence length 65
Comment (tr|G1NJ66|G1NJ66_MELGA) Parvalbumin {ECO:0000313|Ensembl:ENSMGAP00000013352} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=PVALB OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
MAMTDVLSAEDIKKAVGAFSAAESFNYKKFFEMVGLKKKSPEDVKKVFHILDKDRSGFIE
EEELK
Download sequence
Identical sequences G1NJ66
ENSMGAP00000013352 ENSMGAP00000013352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]