SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1NKJ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NKJ1
Domain Number 1 Region: 6-128,162-269
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.9e-74
Family Calponin-homology domain, CH-domain 0.0000532
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1NKJ1
Sequence length 334
Comment (tr|G1NKJ1|G1NKJ1_MELGA) Calmin {ECO:0000313|Ensembl:ENSMGAP00000013949} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=CLMN OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
LIFVVERENVQKRTFTRWINLHLGKCKPPLKVRDLFMDIQDGKILMALLEVLSGQKLMHE
YKSSTHRIFRLNNIAKALKFLEDSNVKLVSIDAAEIADGNSSLVLGLIWNIILFFQIKEL
TGNLNRNSSSSSLSSGPSGPESDTSYPSTPNIERSMSVTVKDQRKAIRALLFWVQRKTRK
YGVAVQDFASSWRSGLAFLAIIKAIDSTLVDMKHALGKPARENLEDAFSIAQNKLGVPRL
LEPEDIMVESPDEQSIVTYVAQFLEHFPELEGEDFTDPEKELPIESTYVHIKDTPSEKES
KILILRESDKNMYTVNHERSHPAPPKVHIHDTPE
Download sequence
Identical sequences G1NKJ1
ENSMGAP00000013949 ENSMGAP00000013949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]