SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1NL95 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NL95
Domain Number 1 Region: 389-624
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.53e-38
Family Calponin-homology domain, CH-domain 0.0000935
Further Details:      
 
Domain Number 2 Region: 87-241,386-469
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.15e-19
Family FAD/NAD-linked reductases, N-terminal and central domains 0.078
Further Details:      
 
Domain Number 3 Region: 1017-1050
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000133
Family LIM domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1NL95
Sequence length 1093
Comment (tr|G1NL95|G1NL95_MELGA) Uncharacterized protein {ECO:0000313|Ensembl:ENSMGAP00000014271} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN= OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
MEESKNEKVNQAHVLFDRFVQASTCKGTLKAFQELCDYLELKPKDYRSFYHKLKSKLNYW
KAKALWAKLDKRGSHKDYKKGKACANTKCLIIGAGPCGLRTAIDLSFLGAKVVVIEKRDA
FSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGSIDHISIRQLQLILLKVALILGIEIHVN
VEFQGLVYPPEDQENERIGWRALVHPKTHPVSEYEFEVIIGGDGRRNTLEGFRRKEFRGK
LAIAITANFINRNTTAEAKVEEISGVAFIFNQKFFQDLREATGIDLENIVYYKDDTHYFV
MTAKKQSLLDKGVIRHDYADTELLLSRENVDQEALLNYAREAADFSTNQQLPSLDFAINH
YGQPDVAMFDFTCMYASENAALVREQNGHQLLVALVGDSLLEPFWPMGTGIARGFLAAMD
SAWMVRSWSLGASPLEVLAERESIYRLLPQTTPENVSKNFSHYSIDPATRYPNINVNFLR
PQQVRHLYNTGDLKDIHLEIENFVNSRTPKLTRNESVARSSKLLSWCQRQTDGYAGVNVT
DLTMSWKSGLALCAIIHRYRPDLIDFDSLDEHNVEKNNQLAFDIAEKEFGISPIMTGKEM
ASVGEPDKLSMVMYLTQFYEMFKDTIPSSGKDSVDLNAEEKAALIASTKSPISFLSKLGQ
SISRKRTPKAAVQDKKEKELDGAGKRRKTSQSEDVIKSFRNRKFHSYLSCSLSAAIGNQN
KVKSMATQLLAKFEENAPEELLMKKKMRSKERSRTCPKKVIMLSSSTPPSSPPYPRLQAA
AVPETSHTFSRNYTIVLAQGLMTSQRYRDPDAGYPGEQSPRQERMTKCLRMLNKGHVSWL
PSWSPDLTALIVSLMNASVIQNSVINRVKSSLQASEHMLKNELDSRSNHLTVLVYQSVAP
QFYLLLEVFLHIYPETEPSRRFFVDHLRSSNRPSSPSSDSLRQKFKDPEAPADTHFRPSS
VTANMPRFLKILKYIKMYTGGVSSLAEQIANQLQRKEQPKTLLDKKELGSLKKEFPQNLG
GSDVCYFCRKRVYVMERLSAEGKFFHRSCFKCEYCATTLRLSSYAYDIEDGKFYCKPHYC
YRLSGYAQRKRPA
Download sequence
Identical sequences G1NL95
ENSMGAP00000014271 ENSMGAP00000014271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]