SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1NM61 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NM61
Domain Number 1 Region: 639-894
Classification Level Classification E-value
Superfamily YWTD domain 1.19e-56
Family YWTD domain 0.00000336
Further Details:      
 
Domain Number 2 Region: 24-283
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-54
Family YWTD domain 0.00000158
Further Details:      
 
Domain Number 3 Region: 336-571
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-49
Family YWTD domain 0.00000361
Further Details:      
 
Domain Number 4 Region: 945-1204
Classification Level Classification E-value
Superfamily YWTD domain 9.02e-40
Family YWTD domain 0.0000386
Further Details:      
 
Domain Number 5 Region: 1335-1373
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000602
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 6 Region: 896-938
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000114
Family EGF-type module 0.018
Further Details:      
 
Domain Number 7 Region: 1256-1296
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 595-641
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000365
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 9 Region: 1297-1333
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000406
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 10 Region: 286-328
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000496
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 11 Region: 1214-1267
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000007
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1NM61
Sequence length 1622
Comment (tr|G1NM61|G1NM61_MELGA) Low-density lipoprotein receptor-related protein {ECO:0000256|PIRNR:PIRNR036314} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=LRP6 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
LNRSVVNMSVCPPHPLFLPLQAAPLLLYANRRDLRLVDAANGKENATVIVGGLEDAAAVD
FVFIKGLIYWSDVSEEAIKRTEFNKSGSVQNVVVSGLLSPDGLACDWLGEKLYWTDSETN
RIEVSNLDGSLRKVLFWQELDQPRAIALDPARGFMYWTDWGEVPKIERAGMDGSSRSIIV
NTDIYWPNGLTLDYEEQKLYWADAKLNFIHKSNLDGSHRQAVVKGSLPHPFALTLFGDTL
YWTDWNTHSILACSKYSGEDLREIHSNIFSPMDIHAFSQKRQPNATNPCGINNGGCSHLC
LMSPTKPSYQCACPTGVKLLENGKTCKDDVGATELLLLARRTDLRRISLDTPDFTDIVLP
LEDIRHAIAIDFDPLEGYIYWTDDEVRAIRRSFVDGSGSQFVVTAQIAHPDGIAVDWVAR
NLYWTDTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAA
LDGSDRIVLVNTSLGWPNGLALDYEESKIYWGDAKTDKIEVMNADGTGRRVLVEDKLPHI
FGFTLLGDYVYWTDWQRRSIERVHKRTAEREIIIDQLPDLMGLKATNVHQIIGLGTNPCA
EDNGGCSHLCLYRPQGLRCACPIGLELINDMKTCIVPEAFLLFSRRADIRRISLETNNNN
VAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVD
WLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKI
DRASMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLDREIIADDLP
HPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNEC
ASSNGHCSHLCLAVPVGGFVCGCPAHYSLNSDNRTCSVHQAPTTFLLFSQKNAINRMVID
EQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNIIRKAQEDGSQSLTVVTSPVPNQ
NLDMQPYDLSIDIYSRYIYWTCEATNVINVTRLDGRPMGVVLKGDQDRPRAIVVNPEKGY
MYFTNLQERSPKIERAALDGTEREILFFRGLSKPIALAIDSQLGKLFWADSDLRRIESSD
LSGANRVVLEDSNILQPVGLTVFENWLYWIDRQQQMIEKIDMTGREGRTKVQARIAQLSD
IHAVKELNVQEYRQHPCSQDNGGCSHICIVKGDGTTRCSCPVHLVLLQDELSCGEPPTCS
PQQFTCFTGEIDCIPVAWRCDGFTECEDHSDEKNCPVCSDTQFQCESGQCIDSALRCNGE
ANCQDNSDEKNCEVLCLTNQFRCASGQCIGKSKKCDHNLDCSDSSDEQGCYTTEEPAPQP
NNTIGSIIGVILTLFVVGAMYFICQRVLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPS
SLSGSLPGMSRGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPS
PATERSHYTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRVTAT
MAKGYTSDLNYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTD
SS
Download sequence
Identical sequences G1NM61
ENSMGAP00000014652 ENSMGAP00000014652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]