SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1NP64 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NP64
Domain Number 1 Region: 4-186
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.8e-66
Family Calponin-homology domain, CH-domain 0.00000378
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1NP64
Sequence length 190
Comment (tr|G1NP64|G1NP64_MELGA) Uncharacterized protein {ECO:0000313|Ensembl:ENSMGAP00000015503} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN= OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
GRRCIEDLFNDFRDGRKLLELLECLTGQKIAKEKGSTRVHALNNVNKALHILQRNNVDLV
NIGSSDIVDGNHKLTLGLIWNIILHWQVKDVMKNIMAGLQQTNSEKILLSWVRQSTRNYP
QVNVINFTSSWSDGLAFNALLHSHRPDLFDWNVVASQQSPVQRLDHAFNIARQHLGIEKL
LDPEDFGVHI
Download sequence
Identical sequences G1NP64
ENSMGAP00000015503 ENSMGAP00000015503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]