SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1NUV4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NUV4
Domain Number 1 Region: 189-376
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.1e-49
Family DBL homology domain (DH-domain) 0.0000148
Further Details:      
 
Domain Number 2 Region: 384-510
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-29
Family Pleckstrin-homology domain (PH domain) 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1NUV4
Sequence length 618
Comment (tr|G1NUV4|G1NUV4_MYOLU) Rho guanine nucleotide exchange factor 25 {ECO:0000313|Ensembl:ENSMLUP00000001022} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=ARHGEF25 OC=Vespertilionidae; Myotis.
Sequence
RGLERPLPSHTVPLMNFXGGMLRACLITRAGGPPKRSPLGPEGTEPESACTEGGQRGERE
PEVPAWAPLPESYSIADSEGSISASAASGLAVPSGPTSGFSSEPCSPGPPGPSSGLRRWL
DHSKHCLSVETEVDGGQAGPYENWMLEPALATGEELPELTLLTTLLEGPGDETKLPEEES
LSQAPESEEEQKKKALERSMYVLGELVETEKMYVEDLGQIVEGYMATMAAQGVPENLRGR
DRIVFGNIQQIYEWHRDYLLGELQRCLKDPDWLAQLFIKHERRLHMYVVYCQNKPKSEHV
VSEFGDSYFEELRQQLGHRLQLNDLLIKPVQRIMKYQLLLKDFLKYYSRAGMDTEELERA
VEVMCFVPKRCNDMMTLGRLRGFEGKLTAQGKLLGQDTFWVTEPEAGGLLSSRGRERRVF
LFEQIVIFSEALGGGVRGGTQPGYVYKSSIKVSCLGLEGNLQGDPCRFALTSRGPEGGIQ
RYVLQTADPAVSQAWIKQVAQILESQRDFLNALQSPIEYQRRESQTNSLGRPGGPGVGSP
GKMRPGDRAQVSTHRPINGSLPSLLLLPKGEVARGSLPLDTQALSDIPQMPRDSPSVPPI
SNTPPCQARLAKLDEDEL
Download sequence
Identical sequences G1NUV4
ENSMLUP00000001022 ENSMLUP00000001022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]