SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1P678 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1P678
Domain Number 1 Region: 1-83
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-24
Family DBL homology domain (DH-domain) 0.0000453
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1P678
Sequence length 84
Comment (tr|G1P678|G1P678_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000005562} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN= OC=Vespertilionidae; Myotis.
Sequence
ECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTTDPTEKANLKLALDAMKDLAQY
VNEVKRDNETLREIRQFQLSIENL
Download sequence
Identical sequences G1P678
ENSMLUP00000005562 ENSMLUP00000005562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]