SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1PA37 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PA37
Domain Number 1 Region: 232-431
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.01e-47
Family DBL homology domain (DH-domain) 0.0000000829
Further Details:      
 
Domain Number 2 Region: 424-548
Classification Level Classification E-value
Superfamily PH domain-like 2.52e-34
Family Pleckstrin-homology domain (PH domain) 0.00000179
Further Details:      
 
Domain Number 3 Region: 1-117
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.36e-26
Family Calponin-homology domain, CH-domain 0.00072
Further Details:      
 
Domain Number 4 Region: 162-232
Classification Level Classification E-value
Superfamily SH3-domain 4.59e-24
Family SH3-domain 0.0000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1PA37
Sequence length 777
Comment (tr|G1PA37|G1PA37_MYOLU) Rac/Cdc42 guanine nucleotide exchange factor 6 {ECO:0000313|Ensembl:ENSMLUP00000007133} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=ARHGEF6 OC=Vespertilionidae; Myotis.
Sequence
MNPEEQIVTWLISLGVLDSPKKTICDPEEFLKSSLKNGVVLCKLINRLRPGSVEKYCLEP
QTEADCINNINDFLKGCVTLQVEVFNPDDLYSGVNFSKVLSTLLAVNKATEDQLSERPCG
RSSSLSAANSSQTNPQGAVSSTAPRLQRQSKAVEMTENGSHQLIVKARFNFKQTNEDELS
VCKGDIIYVTRVEEGGWWEGTLNGRTGWFPSNYVREIKSSERPLSPKAIKGFETTPLTKN
YYSVVLQNILDTEKDYAKELQSLLVTYLRPLQSNNNLSTVEFTSLLGNFEEVCTFQQTLC
QALEECSKFPENQHKVGGCLLNLMPHFKSMYLAYCANHPSAVNVLTQHSDELEQFMENQG
ASSPGILILTTSLSKPFMRLEKYVTLLQELERHMEDTHPDHQDVLKAIIAFKTLMGQCQD
LRKRKQLELQILSEPIQAWEGEDIKTLGNVIFMSQVMVQYGTCEEKEERYLMLFSNVLIM
LSASPRMSGFIYQGKIPIAGMVVTRLDEIEGNDYTFEITGSHILERIVVHCSNNQDFQEW
LEQLYRLIRGPASCSSLSKTSSSSCSAHSSFSSTGQPRGPLEPPQIIKPWSLSCLRPAPP
LRPSAALSYKERMSYILKESSKSPKTMKKFLHKRKTERKPSEEEYVIRKSTAALEEDAQI
LKVIEAYCTSANIQQGHGSSSRKDSVPQVLLPEEEKLIIEETRSNGQTIIEEKSLVDTVY
ALKDEVKELKQVMKYTSRCSRERSRNKMVREKLVRRLLKQTDECIRADSSNKTSILP
Download sequence
Identical sequences G1PA37
ENSMLUP00000007133 ENSMLUP00000007133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]