SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1PAE5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PAE5
Domain Number 1 Region: 414-605
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.28e-38
Family Laminin G-like module 0.007
Further Details:      
 
Domain Number 2 Region: 197-402
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.45e-38
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 3 Region: 609-789
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.45e-37
Family Laminin G-like module 0.0023
Further Details:      
 
Domain Number 4 Region: 6-180
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-33
Family Laminin G-like module 0.0023
Further Details:      
 
Domain Number 5 Region: 815-850
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000035
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1PAE5
Sequence length 851
Comment (tr|G1PAE5|G1PAE5_MYOLU) Neurexin 1 {ECO:0000313|Ensembl:ENSMLUP00000007252} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=NRXN1 OC=Vespertilionidae; Myotis.
Sequence
GKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKN
GAVSLVINLGSGAFEALVEPVNGKFNDNAWHDVKVTRNLRQHSGIGHAMVNKLHCSVTIS
VDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRL
ELSRLAKQGDPKMKIHGVVAFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRT
TEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKV
NDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTE
VWTALLNYGYVGCIRDLFIDGQSKDIRQMAEVQSTAGVKPSCSRETAKPCLSNPCKNNGM
CRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQR
AYGILMATTSRDSADTLRLELDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWH
TVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITERRYLSSVPSNFIGHLQ
SLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIADPVTFKTKSSYVALATLQAYTSMHLF
FQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHN
VMISRDTSNLHTVKIDTKITTQITAGARNLDLKSDLYIGGVAKETYKSLPKLVHAKEGFQ
GCLASVDLNGRLPDLISDALFCNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCS
MTSFSGPLCND
Download sequence
Identical sequences F1MT47 G1PAE5
ENSMLUP00000007252 ENSMLUP00000007252 ENSBTAP00000026956 ENSBTAP00000033006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]