SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1PAQ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PAQ2
Domain Number 1 Region: 2-239
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.51e-57
Family BAR domain 0.0018
Further Details:      
 
Domain Number 2 Region: 345-523
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.67e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.000000329
Further Details:      
 
Domain Number 3 Region: 649-727
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-16
Family SH3-domain 0.00016
Further Details:      
 
Domain Number 4 Region: 212-316
Classification Level Classification E-value
Superfamily PH domain-like 2.41e-16
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1PAQ2
Sequence length 728
Comment (tr|G1PAQ2|G1PAQ2_MYOLU) Rho GTPase activating protein 10 {ECO:0000313|Ensembl:ENSMLUP00000007384} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=ARHGAP10 OC=Vespertilionidae; Myotis.
Sequence
LSAAQRKFAHSLRDFKFEFIGDAETDDERCIDASLREFSNFLKNLEEQREIMALSVTETL
IKPLEKFRKEQLGAVKEEKKKFDKETEKNYSLIDKHLNLSAKKKDSHLQEADVQVEQNRQ
HFYELSLEYVCKLQEIQERKKFEFVEPMLSFFQGMFTFYHQGHELAKDFNHYKMELQINI
QNTRNRFEGTRSEVEELMNKIRQNPKDHKRASQFTAEGYLYVQEKRPAPFGSSWVKHYCM
YRKAAKKFNMIPFEHRSGGKLGDGEVFFLRECTKRHTDSIDRRFCFDVEVADRPGVALTM
QAFSEEERKQWLEALGGKEALLHTFNRAIIPRPEGSAQLDKMGFTILRKCISAVETRGIN
DQGLYRVVGVSSKVQRLLSMLMDVKTCNELDLENSSDWEVKTITSALKQYLRSLPEPLMT
YELHGDFIVPAKSGSPESRVNAIHFLVHKLPEKNKEMLDILVKHLTNVSNHSKQNLMTVA
NLGVVFGPTLMRPQEETVAAIMDLKFQNIVVEILIENHEKIFRTLPAATPPESVSQSPPN
APPRQSKRQGQRTKRPVAVYNLSLQLEDGDSPNPLKEDTPTSSLDSLSSPSPTTASVQGL
PGPDKNHLVADGDWASAASSQTRPPMVQWLNPQSPTTLSCNRAVTPPSPKLSPFLSCPPA
TPADKPPESVTSRKARAVYPCEAEHSSELSFEIGAIFEDVQTSREPGWLEGTLNGKRGLI
PQNYVKLL
Download sequence
Identical sequences G1PAQ2
ENSMLUP00000007384 ENSMLUP00000007384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]