SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1PAS9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PAS9
Domain Number 1 Region: 170-311
Classification Level Classification E-value
Superfamily PH domain-like 1.08e-44
Family Third domain of FERM 0.00000011
Further Details:      
 
Domain Number 2 Region: 60-169
Classification Level Classification E-value
Superfamily Second domain of FERM 2.49e-38
Family Second domain of FERM 0.000000594
Further Details:      
 
Domain Number 3 Region: 461-548
Classification Level Classification E-value
Superfamily Moesin tail domain 5.36e-32
Family Moesin tail domain 0.00000432
Further Details:      
 
Domain Number 4 Region: 3-58
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000132
Family First domain of FERM 0.0000615
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1PAS9
Sequence length 548
Comment (tr|G1PAS9|G1PAS9_MYOLU) Moesin {ECO:0000313|Ensembl:ENSMLUP00000007415} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=MSN OC=Vespertilionidae; Myotis.
Sequence
LFQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNKKVTAQDVRKESPLLFKFRAKFYPEDV
SEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAG
DKLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEMYGVNYFSIK
NKKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVF
YAPRLRINKRILALCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQMERALLENEKKK
REMAEKEKEKIEREKEELMEKLKQIEEQTKKAQQELEEQTRRALELEQERKRAQSEAEKL
AKERQDAEEAKLALLQASRDQKKTQEQLALEMAELTARISQLEMARQKKESEAVEWQQKA
QMVQEDLEKTRAELKTAMSTPHVAEPAENDQDEQDENGAEASADLRADAMAKDRSEEERT
TEAEKNERVQKHLKALTSELANALDESKKTANDMIHAENMRLGRDKYKTLRQIRQGNTKQ
RIDEFESM
Download sequence
Identical sequences G1PAS9
ENSMLUP00000007415 ENSMLUP00000007415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]