SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1PGN5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PGN5
Domain Number 1 Region: 628-883
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-56
Family YWTD domain 0.00000326
Further Details:      
 
Domain Number 2 Region: 17-276
Classification Level Classification E-value
Superfamily YWTD domain 1.12e-54
Family YWTD domain 0.00000154
Further Details:      
 
Domain Number 3 Region: 327-566
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-49
Family YWTD domain 0.00000341
Further Details:      
 
Domain Number 4 Region: 931-1190
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-39
Family YWTD domain 0.0000427
Further Details:      
 
Domain Number 5 Region: 885-932
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000718
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1242-1282
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000128
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 1321-1359
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000016
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 8 Region: 583-630
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000168
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 9 Region: 1283-1319
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 10 Region: 279-321
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000718
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 11 Region: 1200-1253
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000032
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1PGN5
Sequence length 1609
Comment (tr|G1PGN5|G1PGN5_MYOLU) Low-density lipoprotein receptor-related protein {ECO:0000256|PIRNR:PIRNR036314} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=LRP6 OC=Vespertilionidae; Myotis.
Sequence
IVLRTLSARLFIFLAAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVFGHGL
IYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNL
DGSLRKVLFWQELDQPRAIALDPSSGFIYWTDWGEVPKIERAGMDGSSRFVIINTEIYWP
NGLTLDYEERKLYWADAKLNFIHKSNLDGTDRQAVVKGSLPHPFALTLFEDTLYWTDWNT
HSILACNKYTGEGLREIHSNIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMSPVKP
FYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIRHAIA
IDYDPVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGT
DRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRVVL
VNTSLGWPNGLALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDY
VYWTDWQRRSIERVHKRSAEREIIIDQLPDLMGLKATNVHRIIGSNPCADENGGCSHLCL
YRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEA
SALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADT
GTNRIEASKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERT
TLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQYQDY
IYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHCSHLC
LAVPVGGFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILPIHSL
RNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPNQNLEIQPYDLSIDIY
SRYIYWTCEATNVITVTRLDGRSIGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERSPKIE
RAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIVLEDSNI
LQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQEYRQ
HPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCI
PVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEKNCEV
LCLIDQFRCANGQCIGKHKKCDHNMDCSDKSDELDCYPTEEPAPQATNTVGSVIGVIVTI
FVSGTIYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKS
MISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTMEFGY
SSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTTVATAKGYTSDLNYDS
EPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences G1PGN5
ENSMLUP00000009809 ENSMLUP00000009809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]