SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1PIG0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PIG0
Domain Number 1 Region: 9-216
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.000000000864
Family DBL homology domain (DH-domain) 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1PIG0
Sequence length 306
Comment (tr|G1PIG0|G1PIG0_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000010489} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN= OC=Vespertilionidae; Myotis.
Sequence
MCSPQEAALLQLEEVFSATLARISDRVLQPLLTAGASQPSDPQGRECLRLLQQLHGCAQQ
LWEVTERSLRALRERLGHPDAIGLESLLLLREADHVLQVHMEYIESYTSCVVAQAFQKAA
KQRSRYWRDQRKDLRQLLWGVSPKGSMGTALVQALRQPLTHHVQKYALLLLSLRDTIGEC
HPARELVVHAATLFGDLQSFMKQALDQAEATQALWHTLSSRLRDALCTPARRLLQDSQDI
PVTVTPLRAERALLFDDVLVLLQGHSVHTFDLKLVWVDPEQDGCAVHLLTPEEEFFFGSK
SPQDLV
Download sequence
Identical sequences G1PIG0
ENSMLUP00000010489 ENSMLUP00000010489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]