SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1PJ75 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PJ75
Domain Number 1 Region: 15-121
Classification Level Classification E-value
Superfamily Ribosomal protein L20 4.71e-36
Family Ribosomal protein L20 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1PJ75
Sequence length 149
Comment (tr|G1PJ75|G1PJ75_MYOLU) Mitochondrial ribosomal protein L20 {ECO:0000313|Ensembl:ENSMLUP00000010793} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=MRPL20 OC=Vespertilionidae; Myotis.
Sequence
MVFLTTQLWLRSRVTDRYWRVQEVLKHARHFRGRKNRCYRLAVRAVIRAFVKCTKARRRK
RGILRTLWINRITAASQEHGLHYPAFVGNLVKCQVELNRKVLADLAIYEPKTFKSLAALA
KRRREEGFAAALGDGKEPEGIFSRVVQYH
Download sequence
Identical sequences G1PJ75
ENSMLUP00000010793 XP_006108374.1.53796 ENSMLUP00000010793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]