SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1PVN1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PVN1
Domain Number 1 Region: 700-837,897-963
Classification Level Classification E-value
Superfamily Hemopexin-like domain 4.92e-37
Family Hemopexin-like domain 0.00094
Further Details:      
 
Domain Number 2 Region: 69-108
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000301
Family Somatomedin B domain 0.001
Further Details:      
 
Domain Number 3 Region: 27-67
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000745
Family Somatomedin B domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1PVN1
Sequence length 963
Comment (tr|G1PVN1|G1PVN1_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000015408} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=PRG4 OC=Vespertilionidae; Myotis.
Sequence
MEWKILPIHLLLLLSVFLIQQVSSQDVSSCAGRCGEGYSRDTPCNCDYNCQLYMECCPDF
KKFCTVELSCKGRCSESFERGRECDCDNQCKKYGKCCPDYDDFCEASVHSPTPPPSSKAA
PPPAGARQPIKSTTKRSPKPTDKKTTKKVIESEEITEEHSVSENQESSSSSSSSSSSIRK
IKSSKNSAANKELKKKPKVKDNKKENPKKKPAPEPPVVDEAGSGLDEGDSKPTPTPDTPT
TQSTKVTTTSKVTTVTTVSPKPSPSPKPETSKDTSSTASKEKTVETKETSKTTKETSAST
SEKTTSGKETRSAEKTSKDLEATSVSVKTTTEAETTTTSLTPTTPQTPSPTTTTKEPTTT
PKKPEPTTPKKPEPTTPKKPEPTTPKKPPNTSEKPEPTTPKLSIILLRVGCPLFLVDPTP
KAPAGSNSETTTTLKDKTTEKGTHTTTEITTATSTSTTRETATPKEDKTTESQTSTTKQV
TSTTTKDTTSAKVTPKETTPAPEVTPTEDKTTESQTSTTKQVTSTTTKDTTSAKVTPKET
TPAPEVTAATKKTTTTEETTNTSEDTVTTSKVTTAKSPKPTKAPQMPTTTKKPNTTPKVT
KPKPTPSPPKTTTSTVPTMNPASSEEDLLHTTTSSDQASNSEMAEEHPKNEDANDAEGEK
PYVILRPPVITPLIIPGADFTVRGSDQGIGVNPMLSDETNLCNGRSVDGLTTLANGTLVA
FRGEVITFWMLNPLSPPSPPRRITEVWGIPSPIDTVFTRCNCDGKTFFFKGSQYWRFTND
VKDPGYPKQIVKGFGGLNGKILAALSIPKYKERPESVYFFKRVGGRVQKYTYKQEPNRQC
PGRRPALSYPVYGGTTQVRRLRFERAIGSHTHTISIQYSRPVRVLYQDKGFLHNEAQIST
LWRGLPSLVTSAISLPNTRKPDGYDYYAFSRDQAYNLNVPSRTARAVTPPSGKTLSNVWY
NCP
Download sequence
Identical sequences G1PVN1
ENSMLUP00000015408 ENSMLUP00000015408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]