SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1Q1C2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1Q1C2
Domain Number 1 Region: 107-214
Classification Level Classification E-value
Superfamily Second domain of FERM 1.11e-37
Family Second domain of FERM 0.000000679
Further Details:      
 
Domain Number 2 Region: 19-103
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.37e-25
Family First domain of FERM 0.00000582
Further Details:      
 
Domain Number 3 Region: 542-598
Classification Level Classification E-value
Superfamily Moesin tail domain 0.0000000000000418
Family Moesin tail domain 0.004
Further Details:      
 
Domain Number 4 Region: 215-292
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000083
Family Third domain of FERM 0.000059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1Q1C2
Sequence length 608
Comment (tr|G1Q1C2|G1Q1C2_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000017505} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN= OC=Vespertilionidae; Myotis.
Sequence
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETW
FFGLQYTIKDTVAWLKTDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFL
QVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMT
PEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGDALGL
HIYDPENRLTPKISFPWNEIRNIISYSDKEFNFKGILEHLCCLRFCRGKRRCRKSCLSPP
GTLLGEYGRVWVSRVTSQAAVTQRHQGTRQRRAAGQCPTPRWRPRSQVAERGGAAPGDEH
QAPVSNTRLRSACPDLTRQLELLMRSEETADLLAEKAQITEEEAKLLAQKAAEAEQEMQR
IKATAIRTEEENRVMEQKVLEAEVLALKMAEESERRSEAVGGGGGAQLRKCEEALLTFKS
PRLACRSGTTVPWFSVCLGPLPRVRVASPCMMHAGAGSCVLQGKGLAQSGSNLRPSIVVF
VVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHNENADRGGGTGSKHNTIKKPQA
QGRRPICI
Download sequence
Identical sequences G1Q1C2
ENSMLUP00000017505 ENSMLUP00000017505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]