SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1QF80 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1QF80
Domain Number 1 Region: 161-334
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.14e-24
Family DBL homology domain (DH-domain) 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1QF80
Sequence length 730
Comment (tr|G1QF80|G1QF80_MYOLU) Rho guanine nucleotide exchange factor 33 {ECO:0000313|Ensembl:ENSMLUP00000022363} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=ARHGEF33 OC=Vespertilionidae; Myotis.
Sequence
GENEHMPMNNPSTQIYQLQALASELKTGFTEAMQELSRIQHGEYALEEKVKTCKCSMEEK
VTEMKNSLNYFKEELSNAMSMIQAITSKQEEMQQKIEQLQQEKRRESRKVKAKKTQKEEH
GSQAGPAQAQGSPFRSINIPEPVLPSEDFTNLLPSQAYEKAKRQTVALELLESERKYVIN
ISLILKIKATFQGSDGKRNPKERSLFPGSLRYLVQQHLDLLHALQERVLKWPRQGVLGDL
FLKLTNDENNFLDYYVAYLRDLPECISLVHVVVLKEGDEEIKSDIYTLFFHIVQRIPEYL
IHLQNVLKFTEQEHPDYYLLLVCVQRLRVFISHYTLLFQCNEDLLIQKRKKLKKSSMAKL
YKGLASQCANAGQDASPTAGSESARDSGIHSEEMLQPYSPAPGSGSAITHLMPPMKKGQQ
QQSLMDSMQPGKPGEKMEGRKHERPDSLAPAQFCPEQDGKALSGPLAGPSREMDFEPSPA
EPSLGKRGALPCPAPAELLPDARGFAPSAEESEYGELFALARGPTTKEPYQAPAFENCSP
ASSESSLDIMLSATVSFVMEAGAAEAPAAAARRSRPSAHGSHGSHGSAAAAAARGAPRTY
FPQQSKTEPKPGPTCPGSSLASPAAWRGPCQSQRPIKAGAGVKACPDLRCPQRRVLAEKE
IPLLCFQEMHLEDTTRFCPKEERESEQTSFSDQNPRQDQKGGFRSSFRKLFKKKNGNASG
EDFCGPWGWW
Download sequence
Identical sequences G1QF80
ENSMLUP00000022363 ENSMLUP00000022363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]