SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1QHG0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1QHG0
Domain Number 1 Region: 482-628
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.44e-40
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 808-907
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.61e-30
Family Ras-binding domain, RBD 0.00083
Further Details:      
 
Domain Number 3 Region: 228-358
Classification Level Classification E-value
Superfamily PH domain-like 1.93e-21
Family Phosphotyrosine-binding domain (PTB) 0.02
Further Details:      
 
Domain Number 4 Region: 9-104
Classification Level Classification E-value
Superfamily PDZ domain-like 7.19e-21
Family PDZ domain 0.01
Further Details:      
 
Domain Number 5 Region: 753-822
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000105
Family Ras-binding domain, RBD 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1QHG0
Sequence length 1225
Comment (tr|G1QHG0|G1QHG0_NOMLE) Uncharacterized protein {ECO:0000313|Ensembl:ENSNLEP00000000347} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN= OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MFRAGEASKRPLPGPAPPRVRSVEVARGRAGYGFTLSGQAPCVLSCVMRGSPADFVGLRA
GDQILAVNEINVKKASHEDVVKLIGKCSGVLHMVIAEGASRLESCSSDEEGGLYEGKGWL
KPKLDSKALGINRAERVVEEMQSGGIFNMIFENPSLCASSSEPLKLKQRSLSESAATRFD
VGHEGLNNPNPNMLSKEEISKVIHDDSVFSIGLESQDDFALDAGILNVAMIVGYLGSIEL
PSTSSNLESDSLQAIRGCMRRLRAEQKIHSLVTMKIMHDCVQLSTDKAGVVAEYPAEKLA
FSAVCPDDRRFFGLVTMQTNDDGSLAQEEEGALRTSCHVFMVDPDLFNHKIHQGIARVNC
GTLPPPMSKIPADRYRVEGSFAQPPLSAPKREWSRKAFGMQSIFGPHRNVRKTKEDKKGS
KFGRGTGLTQPSQRTSARRSFGRSKRFSITRSLDDLESATVSDGELTGADLKDCVSNNSL
SSNASLPSVQSCRRLRERRVASWAVSFERLLQDPVGVRYFSDFLRKEFSEENILFWQACE
YFNHVPAHDKKELSYRAREIFSKFLCSKATTPVNIDSQAQLADDVLRAPHPDMFKEQQLQ
IFNLMKFDSYTRFLKSPLYQECILAEVEGRALPDSQQVPSSPASKHSLGSDHSSVSTPKK
LSGKSKSGRSLNEEVGDEDSEKKRKGAFFSWSRTRSTGRSQKKREHGDHADDALHANGGL
CRRESQGSVSSAGSLDLSEACRTLAPEKDKATKHCCIHLPDGTSCVVAVRAGFSIKDILS
GLCERHGINGAAADLFLVGGDKPLVLHQDSSILESRDLRLEKRTLFRLDLVPINRSVGLK
AKPTKPVTEVLRPVVAKYGLDLSGLLVRLSGEKEPLDLGAPISSLDGQRVVLEEKDPSRG
KASTDKQKGVPVKQNIAVNSSSRNHSATGEERTLGKSNSIKIKGENGKNARDPRLSKREE
SIAKIGKKKYQKINLDEAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLRLPPGSTEL
TLPTSAAVDQGSWQWLAQRHSWTSVWEAWGRPAAGEGPAHAERGAFLLHLVGPPAGTPPG
KAGQHSRSRQDQPAEGREPWGAREWRGSQVAQATGNKIPAWPQVWMFGDAAPGVRPGGQA
PLEAVQALLGSGTHGSQGLPVNRIIDVDLVTGSAPGRDGGIAGARADPGRSQASGGPPMS
DLPGLSPVSGEPAKPKASAHHATFV
Download sequence
Identical sequences G1QHG0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]