SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1QS81 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1QS81
Domain Number 1 Region: 8-126
Classification Level Classification E-value
Superfamily Histone-fold 3.39e-59
Family Nucleosome core histones 0.00000262
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1QS81
Sequence length 126
Comment (tr|G1QS81|G1QS81_NOMLE) Histone H2B {ECO:0000256|RuleBase:RU000451} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=HIST3H2BB OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MPDPSKSAPAPKKGSKKAVTKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
Download sequence
Identical sequences A0A096NB70 A0A0D9SA35 A0A1A6FVX5 A0A1U7Q8L7 A0A2I3TFZ4 A0A2J8U1R3 A0A2K5BXS7 A0A2K5JLG6 A0A2K5NVX3 A0A2K5PFW2 A0A2K5XHS7 A0A2K6AQZ8 A0A2K6JUW9 A0A2K6NPP3 A0A2K6S2S2 F7BRE5 F7INI0 G1QS81 G3SEH8 G8F2Z1 I3NEZ7 M0RBQ5 Q8CGP0 Q8N257
ENSP00000375736 ENSPTRP00000003521 ENSCJAP00000040592 ENSCJAP00000040592 ENSSTOP00000022944 gi|28173554|ref|NP_778225.1| ENSMMUP00000001936 ENSMMUP00000001936 ENSRNOP00000067000 ENSGGOP00000026510 ENSP00000479284 ENSSTOP00000022944 NP_001103111.1.100692 NP_001103111.1.4139 NP_778225.1.87134 NP_778225.1.92137 XP_001082086.1.72884 XP_003804827.1.60992 XP_004028599.1.27298 XP_005067770.1.91757 XP_005342616.1.77405 XP_005541139.1.63531 XP_006996335.1.50099 XP_007630346.1.28591 XP_007986330.1.81039 XP_008983925.1.60252 XP_009233840.1.23681 XP_010344148.1.74449 XP_010367158.1.97406 XP_011770747.1.29376 XP_011815870.1.43180 XP_011821082.1.47321 XP_011941606.1.92194 XP_012328152.1.9421 XP_012361933.1.23891 XP_015354283.1.40921 XP_017387564.1.71028 XP_017739346.1.44346 XP_020041258.1.5219 XP_021067467.1.100879 XP_021498967.1.76796 ENSPANP00000009991 ENSPTRP00000003521 ENSP00000375736 9544.ENSMMUP00000001936 9598.ENSPTRP00000003521 9606.ENSP00000375736 ENSGGOP00000026510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]