SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1QTV7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1QTV7
Domain Number 1 Region: 356-484
Classification Level Classification E-value
Superfamily Plus3-like 2.75e-46
Family Plus3 0.00000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1QTV7
Sequence length 710
Comment (tr|G1QTV7|G1QTV7_NOMLE) RTF1 homolog, Paf1/RNA polymerase II complex component {ECO:0000313|Ensembl:ENSNLEP00000004375} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=RTF1 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MRGRLCVGRAAAAAAAVAVPLAGGQEGSPGGGRRGSRGTTMVKKRKGRVVIDSDTEDSGS
DENLDQELLSLAKRKRSDSEEKEPPVSQPAASSDSETSDSDDEWTFGSNKNKKKGKARKI
EKKGTMKKQANKTASSGSSDKDSSAESSAPEEGEVSDSDSNSSSSSSDSDSSSEDEEFHD
GYGEDLMGDEEDRARLEQMTEKEREQELFNRIEKREVLKRRFEIKKKLKTAKKKEKKEKK
KKQEEEQEKKKLTQIQESQVTSHNKERRSKRDEKLDKKSQAMEELKAEREKRKNRTAELL
AKKQPLKTSEVYSDDEEEEEDDKSSEKSDRSSRTSSSDEEEEKEEIPPKSQPVSLPEELN
RVRLSRHKLERWCHMPFFAKTVTGCFVRIGIGNHNSKPVYRVAEITGVVETAKVYQLGGT
RTNKGLQLRHGNDQRVFRLEFVSNQEFTESEFMKWKEAMFSAGMQLPTLDEINKKELSIK
EALNYKFNDQDIEEIVKEKERFRKAPPNYAMKKTQLLKEKAMAEDLGDQDKAKQIQDQLN
ELEERAEALDRQRTKNISAISYINQRNREWNIVESEKALVAESHNMKNQQMDPFTRRQCK
PTIVSNSRDPAVQAAILAQLNAKYGSGVLPDAPKEMSKGQGKDKDLNSKSASDLSEDLFK
VHDFDVKIDLQVPSSESKALAITSKAPPAKDGAPRRSLNLEDYKKRRGLI
Download sequence
Identical sequences A0A2J8S5U8 A0A2K5LX58 A0A2K6RET7 G1QTV7 G3RCG4 H2Q980 Q92541
ENSP00000374280 ENSNLEP00000004375 NP_055953.3.87134 NP_055953.3.92137 XP_001142072.1.37143 XP_003266801.1.23891 XP_004056064.1.27298 XP_008015150.1.81039 XP_010367349.1.97406 XP_011890227.1.92194 ENSGGOP00000013192 ENSGGOP00000013192 gi|195976782|ref|NP_055953.3| ENSNLEP00000004375 ENSP00000374280 ENSPTRP00000011849 ENSP00000374280 9598.ENSPTRP00000011849 9606.ENSP00000374280 ENSPTRP00000011849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]