SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1QYJ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1QYJ4
Domain Number 1 Region: 1-347
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 1.44e-73
Family ADP-ribosylglycohydrolase 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1QYJ4
Sequence length 357
Comment (tr|G1QYJ4|G1QYJ4_NOMLE) ADP-ribosylarginine hydrolase {ECO:0000313|Ensembl:ENSNLEP00000006015} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=ADPRH OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MEKYVAAMVLSAAGDALGYYNGKWEFLQDGEKIHRQLAQLGGLDALDVGRWRVSDDTVMH
LATAEALVEAGKAPKLTRLYYLLAKHYQDCMEDMDGRAPGNASVHNAMQLKPGKPNGWRI
PFNSHEGGCGAAMRAMCIGLRFPHHSQLDTLIQVSIESGRMTHHHPTGYLGALASALFTA
YAVNARPPLQWGKGLMELLPEAKKYVVQSGYFVEENLQHWSYFQTKWENYLKLRGILDGE
SAPTFPEPFGVKERDQFYTSLSYSGWGGSSGHDAPMIAYDAVLAAGDSWKELAHRAFFHG
GDSDSTAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLGSKEDTVISL
Download sequence
Identical sequences G1QYJ4
ENSNLEP00000006015 ENSNLEP00000006015 XP_003261903.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]