SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1R447 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1R447
Domain Number 1 Region: 30-290
Classification Level Classification E-value
Superfamily YWTD domain 7.59e-54
Family YWTD domain 0.00000168
Further Details:      
 
Domain Number 2 Region: 621-823
Classification Level Classification E-value
Superfamily YWTD domain 3.79e-46
Family YWTD domain 0.0000182
Further Details:      
 
Domain Number 3 Region: 341-550
Classification Level Classification E-value
Superfamily YWTD domain 1.07e-45
Family YWTD domain 0.00000431
Further Details:      
 
Domain Number 4 Region: 870-1077
Classification Level Classification E-value
Superfamily YWTD domain 5.1e-29
Family YWTD domain 0.00017
Further Details:      
 
Domain Number 5 Region: 1240-1276
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000668
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1202-1238
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000419
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1162-1200
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000537
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 826-873
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000089
Family EGF-type module 0.02
Further Details:      
 
Domain Number 9 Region: 559-605
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000115
Family EGF-type module 0.009
Further Details:      
 
Domain Number 10 Region: 296-338
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000623
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1119-1171
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000488
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1R447
Sequence length 1510
Comment (tr|G1R447|G1R447_NOMLE) LDL receptor related protein 5 {ECO:0000313|Ensembl:ENSNLEP00000007969} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=LRP5 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
VPSAPPPVPGPTILLSPVALTVCFCPTASPLLLFANRRDVRLVDAGGVKLESTVVVSGLE
DAAAVDFQFSKGAVYWTDVSEEAIKQTYLNQTGVAVQNVVISGLVSPDGLACDWVGKKLY
WTDSETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDG
STRKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFAL
TLSGDTLYWTDWQTRSIHACNKRTGGKRKEILSALYSPMDIQVLSQERQPFFHTRCEEDN
GGCSHLCLLSPREPFYTCACPTGVQLQDNGRTCKAGAEEVLLLARRTDLRRISLDTPDFT
DIVLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLVNTEINDPDGIAV
DWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIALHPVMGLMYWTDWGENPK
IECANLDGQERRVLVNASLGWPNGLALDLQEGKLYWGDAKTDKIEVINVDGTKRRTLLED
KLPHIFGFTLLEPLCSLPGTNPCADRNGGCSHLCFFTPRATRCGCPIGLELLSDKKTCIV
PEAFLVFTIIMALFLLTCCQTISRAFMNGSSVEHVVEFGLDYPEGMAVDWMGKNLYWADT
GTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTKGYIYWTEWGGKPRIVRAFMDGTNCM
TLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQERVVIADDLPHPFGLTQYSDY
IYWTDWNLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQDGLNDCMHNNGQCGQLC
LAIPGGHRCGCASHYTLDPSSRNCSPPTTFLLFSQKSAISRMIPDDQHSPDLILPLHGLR
NVKAIDYDPLDKFIYWVDGRQNIKRAKDDGTQPFVLTSLSQGQNPDRQPHDLSIDIYSRT
LFWTCEATNTINVHRLSGEAMGVVLRGDRDKPRAIVVNAERGYLYFTNMQDRAAKIERAA
LDGTEREVLFTTGLIRPVALVVDNTLGKLFWVDADLKRIESCDLSGTAWLTWVLCPGSHG
SRIKVSATLGPQRRLHGEIGFLVGGRADLHLSCFVFAAAHPCARDNGGCSHICIAKGDGT
PRCSCPVHLVLLQNLLTCGEPPTCSPDQFACATGEIDCIPGAWRCDGFPECDDQSDEEGC
PVCSAAQFPCARGQCVDLRLRCDGEADCQDRSDEADCDAICLPNQFRCASGQCVLIKQQC
DSFPDCIDGSDELMCEITKPPSDDSPAHSSAIGPVIGIILSLFVMGGVYFVCQRVVCQRY
AGANGPFPHEYVSGTPHVPLNFIAPGGSQHGPFTGKEPEIWNDLEEGLRGHLPLLGAGRR
GSRSPWLGSPQILNPPPSPATDPSLYNMDMFYSSNIPATARPYRPYIIRGMAPPTTPCST
DVCDSDYSASRWKASKYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPATERSYFHLFP
PPPSPCTDSS
Download sequence
Identical sequences G1R447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]