SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1S2V0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1S2V0
Domain Number 1 Region: 145-459
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.7e-99
Family Protein kinases, catalytic subunit 0.0000000000568
Further Details:      
 
Domain Number 2 Region: 1-113
Classification Level Classification E-value
Superfamily PH domain-like 1.21e-24
Family Pleckstrin-homology domain (PH domain) 0.000000632
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1S2V0
Sequence length 480
Comment (tr|G1S2V0|G1S2V0_NOMLE) Non-specific serine/threonine protein kinase {ECO:0000256|SAAS:SAAS01030073} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=AKT1 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
Download sequence
Identical sequences A0A2J8SZ71 B0LPE5 G1S2V0 G3RB32 K7AGW5 P31749
ENSNLEP00000019838 ENSP00000270202 ENSP00000384293 ENSP00000385326 ENSP00000450688 ENSP00000451166 ENSP00000451828 ENSGGOP00000012669 ENSGGOP00000017521 9606.ENSP00000270202 NP_001014431.1.87134 NP_001014431.1.92137 NP_001014432.1.87134 NP_001014432.1.92137 NP_005154.2.87134 NP_005154.2.92137 XP_003807047.1.60992 XP_005267458.1.92137 XP_012353538.1.23891 XP_016782303.1.37143 XP_016782304.1.37143 XP_016782305.1.37143 XP_018865051.1.27298 ENSGGOP00000012669 gi|62241011|ref|NP_005154.2| gi|62241013|ref|NP_001014431.1| gi|62241015|ref|NP_001014432.1| ENSNLEP00000019838 ENSP00000270202 ENSP00000384293 ENSP00000385326 ENSP00000450688 ENSP00000451166 ENSP00000451828 ENSP00000270202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]