SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1S383 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1S383
Domain Number 1 Region: 153-301
Classification Level Classification E-value
Superfamily EF-hand 8.11e-53
Family Osteonectin 0.0000000717
Further Details:      
 
Domain Number 2 Region: 95-150
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000152
Family Ovomucoid domain III-like 0.0000355
Further Details:      
 
Domain Number 3 Region: 70-94
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000122
Family Follistatin (FS) module N-terminal domain, FS-N 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1S383
Sequence length 303
Comment (tr|G1S383|G1S383_NOMLE) Secreted protein acidic and cysteine rich {ECO:0000313|Ensembl:ENSNLEP00000019971} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=SPARC OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAE
ETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFD
SSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYE
RDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQ
HPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKD
LVI
Download sequence
Identical sequences A0A2J8X6E5 A0A2K5K968 A0A2K6MX34 A0A2K6PQ30 G1S383 H2QRU3 P09486 Q5R767
ENSP00000231061 ENSP00000231061 gi|4507171|ref|NP_003109.1| 9598.ENSPTRP00000029789 9606.ENSP00000231061 ENSPTRP00000029789 ENSNLEP00000019971 ENSPTRP00000029789 ENSP00000231061 NP_003109.1.87134 NP_003109.1.92137 XP_001168719.1.37143 XP_003276595.1.23891 XP_008952671.1.60992 XP_008952672.1.60992 XP_010356959.1.97406 XP_011787019.1.43180 XP_017731219.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]