SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1SE51 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1SE51
Domain Number 1 Region: 901-1104
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000279
Family WD40-repeat 0.026
Further Details:      
 
Weak hits

Sequence:  G1SE51
Domain Number - Region: 433-486
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.00222
Family RILP dimerisation region 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1SE51
Sequence length 1250
Comment (tr|G1SE51|G1SE51_RABIT) Sperm associated antigen 9 {ECO:0000313|Ensembl:ENSOCUP00000000711} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=SPAG9 OC=Oryctolagus.
Sequence
MLLRDDNEQLITQYEREKALRKHAEEKFIEFEDSQEQEKKDLQTRVESLESQTRQLELKA
KNYADQISRLEEREAELKKEYNALHQRHTEMIHNYMEHLERTKLHQLSGSDQLESAAHSR
IRSVNKTQTIGLFCSSFPVTDGGSGCNCQKXGETPGSEQWKFQELSQPRSHTSSRKVSNS
PEPPKAVEQEDELSDVSQSGSKATTPASTINSDVAAIPTDTPLREDNEGFVKVTDTPNKS
EISKHIEVQVAQETRNVSTGSAENEEKSEVQAIIESTPELDMDKDLSGYKGSSTPTKGIE
NKAFDRNTESLFEELSSAGSGLIGDVDEGADLLGMGREVENLILENTQLLETKNALNVVK
NDLIAKVDELTCEKDVLQGELEAVQQAKLKLEEKNKELEEELRKARAEAEDARQKAKDDD
DSDIPTAQRKRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRENPAMQEKKRSS
IWQFFSRLFSSSSNTAKKPEPPVNLKYNAPTSHVTPSVKKRSSTLSQLPGDKSKAFDFLS
EETEASLASRREQKREQYRQVKAHVQKEDGRVQAFGWSLPQKYKQVTNGQGENKMKNLPV
PVYLRPLDEKDASMKLWCAVGVNLSGGKTRDGGSVVGASVFYKDVAGLETEGSEQRSASQ
SSLDKLDQELKDQQKELKSQEELSSQVWICTSTHSATKVIIIDAIQPGNILDSFTVCNSH
VLCIASVPGARETDYPAGEELSEAGQVDKASLCGSMTSNSSAETDSLLGGIAVVGCSTES
AAGAAISPSPNGASPVIEKLPEMESENTEVDESVPTAEEATEATEGNAGSAEDAMDISQP
GVYTEHVFTDPLGVQIPEDLSPVYQSSNDSDAYKDQISVLPDEQDLVREEAQKMSSLLPT
MWLGAQNGCLYVHSSVAQWRKCLHSIKLKDSILSIVHVKGIVLVALADGTLAIFHRGVDG
QWDLSNYHLLDLGRPHHSIRCMTVVHDKVWCGYRNKIYVVQPKAMKIEKSFDAHPRKESQ
VRQLAWVGDGVWVSIRLDSTLRLYHAHTYQHLQDVDIEPYVSKMLGTGKLGFSFVRITAL
MVSCNRLWVGTGNGVIISIPLTETNKTSGAPGNRPGSVIRVYGDENSDKVTPGTFIPYCS
MAHAQLCFHGHRDAVKFFVAVPGQVISPQSGSSGTDLTGDKAGPSAQEPGSQTPLKSMLV
ISGGEGYIDFRMGDEGGDSELLGEDLPLEPSVTRAERSHLIVWQVMYGSE
Download sequence
Identical sequences G1SE51
ENSOCUP00000000711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]