SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1SEL6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1SEL6
Domain Number 1 Region: 156-251
Classification Level Classification E-value
Superfamily S13-like H2TH domain 2.22e-22
Family Middle domain of MutM-like DNA repair proteins 0.015
Further Details:      
 
Domain Number 2 Region: 62-112
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 0.00000196
Family N-terminal domain of MutM-like DNA repair proteins 0.01
Further Details:      
 
Domain Number 3 Region: 319-346
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000011
Family Ran binding protein zinc finger-like 0.0044
Further Details:      
 
Weak hits

Sequence:  G1SEL6
Domain Number - Region: 246-283
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00371
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1SEL6
Sequence length 601
Comment (tr|G1SEL6|G1SEL6_RABIT) Nei like DNA glycosylase 3 {ECO:0000313|Ensembl:ENSOCUP00000000900} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=NEIL3 OC=Oryctolagus.
Sequence
MVEGPGCTLNGEKIRTRVLPGQAVTEVRGTALPSLQGAALPLAASAAVVSSQDSALNDNN
YYIQNVSRQFHGYVYSGVETLGKELFLYFGPKAVRIHFGMKGFIKINPLEYKNKNGVPPV
FEVQLTKDLICFFDSSVELRNSMESQQRIRMMEELDVCSPKFSFSRAETEIIKQKGRMLC
DVLLDQKVLPGVGNIIKNEALFDSGVHPAVKVCQLTDKQTHHLVKMVRDFSILFYKCLKT
GLAISKHYKVYKRHNCGQCHCKITVCRLGENNRMTYFCPHCQKENPQLIDICKLPTRNTV
VGWKSSREDHLMDSVAQKSEEQWVCVACTLINKPSSKACDACLTSRPVDSLFKNEENSVA
FNSLVKYPCNSFGKPHTELKINRKTAFGTTTLVLTDLSNKSSTLERTKSPNQILDGEFQN
LPSTNISLSEAQYPSKERTNYVAQPSNKVKIAPTVFSQSKLFSPAHKKLKTTHYSSLDLQ
SCKPGFSNSELQINMTDGPCTLNAGSPRCSKHNRLCILRVVRKDGENKGRQFYACPLPGE
AQCGFFEWADLSFPLCNHGKRSIMRTVLKIGPNNGRNFFVCPLGKEKQCDFFQWAENRPG
N
Download sequence
Identical sequences G1SEL6
XP_008248298.1.1745 ENSOCUP00000000900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]